PD-1, Mouse (HEK293, His)
PD-1 Protein is an important immune regulatory molecule expressed on the surface of activated immune cells. By binding to its ligands (PD-L1/PD-L2), the PD-1 Protein exerts immunosuppressive effects. PD-1 Protein can be used in the research of tumors, autoimmune diseases, and other conditions. PD-1 Protein, Mouse (HEK293, His) is a recombinant PD-1 protein expressed by HEK293 cells and carries a C-6*His tag and glycosylation modification[1][2].
Product Specifications
Product Name Alternative
PD-1 Protein, Mouse (HEK293, His), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/pd-1-protein-mouse-hek-293-his.html
Purity
99.00
Smiles
LEVPNGPWRSLTFYPAWLTVSEGANATFTCSLSNWSEDLMLNWNRLSPSNQTEKQAAFCNGLSQPVQDARFQIIQLPNRHDFHMNILDTRRNDSGIYLCGAISLHPKAKIEESPGAELVVTERILETSTRYPSPSPKPEGRFQ
Molecular Formula
18566 (Gene_ID) Q02242 (L25-Q167) (Accession)
Molecular Weight
Approximately 25-43 kDa due to the glycosylation.
References & Citations
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Recombinant Human TTC5 Protein - (Dry Ice)
Chicken Cripto, FRL-1, Cryptic Family 1 (CFC1) ELISA Kit
SPSB2 (SPRY Domain-containing SOCS Box Protein 2, SSB2, SSB-2, Gene-rich Cluster Protein C9, GRCC9) (HRP)
SPSB2 (SPRY Domain-containing SOCS Box Protein 2, SSB2, SSB-2, Gene-rich Cluster Protein C9, GRCC9) (HRP)