Complement C5a, Cynomolgus
Complement C5 is activated by C5 convertase, inducing C5-C9 assembly to form the membrane attack complex. The transient C6 binding site on C5b is critical for the formation of the cleavage complex. Complement C5a Protein, Cynomolgus is the recombinant cynomolgus-derived Complement C5/C5a protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
Complement C5a Protein, Cynomolgus, Cynomolgus, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/complement-c5-c5a-protein-cynomolgus.html
Purity
98.00
Smiles
MLQEKIEEIAAKYKHLVVKKCCYDGVRINHDETCEQRAARISVGPRCVKAFTECCVVASQLRANNSHKDLQLGR
Molecular Formula
102125658 (Gene_ID) XP_015292262.1 (M678-R751) (Accession)
Molecular Weight
Approximately 11 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Hox A5, CT (Homeobox A5, Homeobox Protein Hox-A5, HOXA5, HOX1, HOX1.3, Homeobox Protein Hox-1C, HOX1C, MGC9376) (MaxLight 650)
Hox A5, CT (Homeobox A5, Homeobox Protein Hox-A5, HOXA5, HOX1, HOX1.3, Homeobox Protein Hox-1C, HOX1C, MGC9376) (MaxLight 650)
Recombinant Escherichia coli O157:H7 Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (accD)
Recombinant Escherichia coli O157:H7 Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (accD)