Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Frizzled-6, Human (HEK293, His)

Frizzled-6 is a Wnt receptor that complexly activates signaling pathways that converge primarily on the β-catenin canonical pathway. This triggers disorganized protein activation, GSK-3 kinase inhibition, nuclear β-catenin accumulation, and Wnt target gene activation. Frizzled-6 Protein, Human (HEK293, His) is the recombinant human-derived Frizzled-6 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Frizzled-6 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/frizzled-6-protein-human-hek293-his.html

Purity

98.00

Smiles

HSLFTCEPITVPRCMKMAYNMTFFPNLMGHYDQSIAAVEMEHFLPLANLECSPNIETFLCKAFVPTCIEQIHVVPPCRKLCEKVYSDCKKLIDTFGIRWPEELECDRLQYCDETVPVTFDPHTEFLGPQKKTEQV

Molecular Formula

8323 (Gene_ID) O60353-1/NP_003497.2 (H19-V153) (Accession)

Molecular Weight

Approximately 20-28 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rubrobacter xylanophilus Nucleoside diphosphate kinase (ndk)
MBS1455745-01 0.02 mg (E-Coli)

Recombinant Rubrobacter xylanophilus Nucleoside diphosphate kinase (ndk)

Sign In for Pricing
View Details
Recombinant Rubrobacter xylanophilus Nucleoside diphosphate kinase (ndk)
MBS1455745-02 0.1 mg (E-Coli)

Recombinant Rubrobacter xylanophilus Nucleoside diphosphate kinase (ndk)

Sign In for Pricing
View Details
Recombinant Rubrobacter xylanophilus Nucleoside diphosphate kinase (ndk)
MBS1455745-03 0.02 mg (Yeast)

Recombinant Rubrobacter xylanophilus Nucleoside diphosphate kinase (ndk)

Sign In for Pricing
View Details
Recombinant Rubrobacter xylanophilus Nucleoside diphosphate kinase (ndk)
MBS1455745-04 0.1 mg (Yeast)

Recombinant Rubrobacter xylanophilus Nucleoside diphosphate kinase (ndk)

Sign In for Pricing
View Details
Recombinant Rubrobacter xylanophilus Nucleoside diphosphate kinase (ndk)
MBS1455745-05 0.02 mg (Baculovirus)

Recombinant Rubrobacter xylanophilus Nucleoside diphosphate kinase (ndk)

Sign In for Pricing
View Details
Recombinant Rubrobacter xylanophilus Nucleoside diphosphate kinase (ndk)
MBS1455745-06 0.02 mg (Mammalian-Cell)

Recombinant Rubrobacter xylanophilus Nucleoside diphosphate kinase (ndk)

Sign In for Pricing
View Details