Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C-C motif chemokine 3-like 1 protein (CCL3L1) (Active)

Product Specifications

Product Name Alternative

G0/G1 switch regulatory protein 19-2 PAT 464.2, Small-inducible cytokine A3-like 1, Tonsillar lymphocyte LD78 beta protein

Abbreviation

Recombinant Human CCL3L1 protein (Active)

Gene Name

CCL3L1

UniProt

P16619

Expression Region

24-93aa

Organism

Homo sapiens (Human)

Target Sequence

APLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

E.Coli

Field of Research

Immunology

Relevance

Chemotactic for lymphocytes and monocytes. Is a ligand for CCR1, CCR3 and CCR5. Is an inhibitor of HIV-1-infection. The processed form LD78-beta (3-70) shows a 20-fold to 30-fold higher chemotactic activity and is a very potent inhibitor of HIV-1-infection. LD78-beta (3-70) is also a ligand for CCR1, CCR3 and CCR5. {ECO:0000269|PubMed:10961862, ECO:0000269|PubMed:11449371}.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

>97% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration range of 1.0-10 ng/ml.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 µm filtered PBS, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Chemotactic for lymphocytes and monocytes. Is a ligand for CCR1, CCR3 and CCR5. Is an inhibitor of HIV-1-infection. The processed form LD78-beta (3-70) shows a 20-fold to 30-fold higher chemotactic activity and is a very potent inhibitor of HIV-1-infection. LD78-beta (3-70) is also a ligand for CCR1, CCR3 and CCR5.

Molecular Weight

7.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-LRP1/Lrp 1 Cluster Ii Rabbit Monoclonal Antibody
MBS179466-01 0.03 mL

Anti-LRP1/Lrp 1 Cluster Ii Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-LRP1/Lrp 1 Cluster Ii Rabbit Monoclonal Antibody
MBS179466-02 0.1 mL

Anti-LRP1/Lrp 1 Cluster Ii Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-LRP1/Lrp 1 Cluster Ii Rabbit Monoclonal Antibody
MBS179466-03 5x 0.1 mL

Anti-LRP1/Lrp 1 Cluster Ii Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CHMP4B+CHMP4C Polyclonal Antibody, Cy3 Conjugated
bs-7744R-Cy3 100 µL

CHMP4B+CHMP4C Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
ZADH2 Blocking Peptide
MBS9624811-01 1 mg

ZADH2 Blocking Peptide

Sign In for Pricing
View Details
ZADH2 Blocking Peptide
MBS9624811-02 5x 1 mg

ZADH2 Blocking Peptide

Sign In for Pricing
View Details