Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Chymotrypsin-like elastase family member 2A (CELA2A)

Product Specifications

Product Name Alternative

Elastase II; Elastase-2; Elastase-2A

Abbreviation

Recombinant Bovine CELA2A protein

Gene Name

CELA2A

UniProt

Q29461

Expression Region

29-269aa

Organism

Bos taurus (Bovine)

Target Sequence

VVGGEDARPNSWPWQVSLQYSSSGQWRHTCGGSLIEQNWVLTAAHCISSSRTYRVVVGRQSLSTVESGSLTIAVSKSVIHEKWNSNQLAQGNDIALLKLASSVPLTDKIQLGCLPAAGTILPNNYVCYVTGWGRLQSNGALPDILQQGKLLVVDYATCSNPSWWGSTVKTNMICAGGDGVTSSCNGDSGGPLNCQAANRQWQVHGIVSFGSSLGCNYYRKPSVFTRVSNYNDWISSVIENN

Tag

N-terminal 10xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Elastase that enhances insulin signaling and might have a physiologic role in cellular glucose metabolism. Circulates in plasma and reduces platelet hyperactivation, triggers both insulin secretion and degradation, and increases insulin sensitivity.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Bioactivity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

32.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Nuclear Receptor Interacting Protein 1 ELISA Kit
MBS748978-01 48 Well

Canine Nuclear Receptor Interacting Protein 1 ELISA Kit

Sign In for Pricing
View Details
Canine Nuclear Receptor Interacting Protein 1 ELISA Kit
MBS748978-02 96 Well

Canine Nuclear Receptor Interacting Protein 1 ELISA Kit

Sign In for Pricing
View Details
Canine Nuclear Receptor Interacting Protein 1 ELISA Kit
MBS748978-03 5x 96 Well

Canine Nuclear Receptor Interacting Protein 1 ELISA Kit

Sign In for Pricing
View Details
Canine Nuclear Receptor Interacting Protein 1 ELISA Kit
MBS748978-04 10x 96 Well

Canine Nuclear Receptor Interacting Protein 1 ELISA Kit

Sign In for Pricing
View Details
Acylated Ghrelin (AG) Human ELISA Kit
94920 96 Tests

Acylated Ghrelin (AG) Human ELISA Kit

Sign In for Pricing
View Details
Human IMA (Ischemia Modified Albumin) ELISA Kit
ELK5368-01 48 Tests

Human IMA (Ischemia Modified Albumin) ELISA Kit

Sign In for Pricing
View Details