Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Matrilysin (Mmp7)

Product Specifications

Product Name Alternative

Matrin; Matrix metalloproteinase-7; MMP-7; Pump-1 protease; Uterine metalloproteinase

Abbreviation

Recombinant Rat Mmp7 protein

Gene Name

Mmp7

UniProt

P50280

Expression Region

98-267aa

Organism

Rattus norvegicus (Rat)

Target Sequence

FSLMPNSPKWHSRTVTYRIVSYTTDLPRFLVDQIVKRALRMWSMQIPLNFKRVSWGTADIIIGFARGDHGDNFPFDGPGNTLGHAFAPGPGLGGDAHFDKDEYWTDGEDSGVNFLFVATHELGHSLGLGHSSVPSSVMYPTYQGDHSEDFSLTKDDIAGIQKLYGKRNKL

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Degrades casein, gelatins of types I, III, IV, and V, and fibronectin. Activates procollagenase.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

25.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human RPS19 Protein
PKSH032021-01 10 µg

Recombinant Human RPS19 Protein

Sign In for Pricing
View Details
Recombinant Human RPS19 Protein
PKSH032021-02 50 µg

Recombinant Human RPS19 Protein

Sign In for Pricing
View Details
TLE 1 (TLE1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D8]
TA800318AM 100 µL

TLE 1 (TLE1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D8]

Sign In for Pricing
View Details
Biotin Conjugated Human TRAIL Recombinant Rabbit Monoclonal Antibody [PSH08-06]
HA722945B 100 µL

Biotin Conjugated Human TRAIL Recombinant Rabbit Monoclonal Antibody [PSH08-06]

Sign In for Pricing
View Details
DERL1 Rabbit Polyclonal Antibody
TA375422 100 µL

DERL1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Blocks, Breast, left
CB648898 1 Block

Frozen Tissue Blocks, Breast, left

Sign In for Pricing
View Details