Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Adiponectin/Acrp30, Human (HEK293, His)

Adiponectin/Acrp30 Protein, Human (HEK293, His) could increase cell sensitivity to insulin and can be used as a potential protein for treating diabetic tendinopathy[1].

Product Specifications

Product Name Alternative

Adiponectin/Acrp30 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/adiponectin-acrp30-protein-human-hek293-his.html

Purity

98.0

Smiles

ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN

Molecular Formula

9370 (Gene_ID) Q15848 (E19-N244) (Accession)

Molecular Weight

32-40 kDa

References & Citations

[1]Kumada M, et al. Adiponectin specifically increased tissue inhibitor of metalloproteinase-1 through interleukin-10 expression in human macrophages. Circulation. 2004 May 4;109 (17) :2046-9.|[2]Rothan HA, et al. Recombinant human adiponectin as a potential protein for treating diabetic tendinopathy promotes tenocyte progenitor cells proliferation and tenogenic differentiation in vitro. Int J Med Sci. 2013 Nov 27;10 (13) :1899-906.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat Nuclear envelope pore membrane protein POM 121 (Pom121) , partial
MBS948032-01 1 mg (E-Coli)

Recombinant Rat Nuclear envelope pore membrane protein POM 121 (Pom121) , partial

Sign In for Pricing
View Details
Recombinant Rat Nuclear envelope pore membrane protein POM 121 (Pom121) , partial
MBS948032-02 1 mg (Yeast)

Recombinant Rat Nuclear envelope pore membrane protein POM 121 (Pom121) , partial

Sign In for Pricing
View Details
RPS3AP32 3'UTR Luciferase Stable Cell Line
TU021759 1.0 mL

RPS3AP32 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
C4BPB (NM_001017365) Human Recombinant Protein
TP302799M 100 µg

C4BPB (NM_001017365) Human Recombinant Protein

Sign In for Pricing
View Details
Il10rb sgRNA CRISPR Lentivector (Rat) (Target 1)
K6165302 1.0 µg DNA

Il10rb sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
CLDN12 Polyclonal Antibody
MBS2563259-01 0.02 mL

CLDN12 Polyclonal Antibody

Sign In for Pricing
View Details