Adiponectin/Acrp30, Human (HEK293, His)
Adiponectin/Acrp30 Protein, Human (HEK293, His) could increase cell sensitivity to insulin and can be used as a potential protein for treating diabetic tendinopathy[1].
Product Specifications
Product Name Alternative
Adiponectin/Acrp30 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/adiponectin-acrp30-protein-human-hek293-his.html
Purity
98.0
Smiles
ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN
Molecular Formula
9370 (Gene_ID) Q15848 (E19-N244) (Accession)
Molecular Weight
32-40 kDa
References & Citations
[1]Kumada M, et al. Adiponectin specifically increased tissue inhibitor of metalloproteinase-1 through interleukin-10 expression in human macrophages. Circulation. 2004 May 4;109 (17) :2046-9.|[2]Rothan HA, et al. Recombinant human adiponectin as a potential protein for treating diabetic tendinopathy promotes tenocyte progenitor cells proliferation and tenogenic differentiation in vitro. Int J Med Sci. 2013 Nov 27;10 (13) :1899-906.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6351632-01 0.2 mL
STAC, CT (STAC, SH3 and cysteine-rich domain-containing protein, Src homology 3 and cysteine-rich domain-containing protein) (APC)
Sign In for Pricing
View Details MBS6351632-02 5x 0.2 mL
STAC, CT (STAC, SH3 and cysteine-rich domain-containing protein, Src homology 3 and cysteine-rich domain-containing protein) (APC)
Sign In for Pricing
View Details NBP1-76553MFV500 0.1 mL
Rabbit Polyclonal ZMIZ1/Zimp10 Antibody [mFluor Violet 500 SE]
Sign In for Pricing
View Details 