Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Adiponectin/Acrp30, Human (HEK293, His)

Adiponectin/Acrp30 Protein, Human (HEK293, His) could increase cell sensitivity to insulin and can be used as a potential protein for treating diabetic tendinopathy[1].

Product Specifications

Product Name Alternative

Adiponectin/Acrp30 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/adiponectin-acrp30-protein-human-hek293-his.html

Purity

98.0

Smiles

ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN

Molecular Formula

9370 (Gene_ID) Q15848 (E19-N244) (Accession)

Molecular Weight

32-40 kDa

References & Citations

[1]Kumada M, et al. Adiponectin specifically increased tissue inhibitor of metalloproteinase-1 through interleukin-10 expression in human macrophages. Circulation. 2004 May 4;109 (17) :2046-9.|[2]Rothan HA, et al. Recombinant human adiponectin as a potential protein for treating diabetic tendinopathy promotes tenocyte progenitor cells proliferation and tenogenic differentiation in vitro. Int J Med Sci. 2013 Nov 27;10 (13) :1899-906.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trim21 ORF Vector (Mouse) (pORF)
ORF060361 1.0 µg DNA

Trim21 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
AACP Protein Vector (Human) (pPB-His-MBP)
PV318530 500 ng

AACP Protein Vector (Human) (pPB-His-MBP)

Sign In for Pricing
View Details
RPL6 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV698533 1.0 µg DNA

RPL6 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
CEACAM5 Protein (C-Human Fc tag, )
P509947 100 µg

CEACAM5 Protein (C-Human Fc tag, )

Sign In for Pricing
View Details
RNU7-84P Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV774616 1.0 µg DNA

RNU7-84P Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Lentiviral human GALNT9 shRNA (UAS) - Lentiviral human GALNT9 shRNA (UAS, RFP) plasmid
GTR15088489 1 Vial

Lentiviral human GALNT9 shRNA (UAS) - Lentiviral human GALNT9 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details