Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Adiponectin/Acrp30, Human (HEK293, His)

Adiponectin/Acrp30 Protein, Human (HEK293, His) could increase cell sensitivity to insulin and can be used as a potential protein for treating diabetic tendinopathy[1].

Product Specifications

Product Name Alternative

Adiponectin/Acrp30 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/adiponectin-acrp30-protein-human-hek293-his.html

Purity

98.0

Smiles

ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN

Molecular Formula

9370 (Gene_ID) Q15848 (E19-N244) (Accession)

Molecular Weight

32-40 kDa

References & Citations

[1]Kumada M, et al. Adiponectin specifically increased tissue inhibitor of metalloproteinase-1 through interleukin-10 expression in human macrophages. Circulation. 2004 May 4;109 (17) :2046-9.|[2]Rothan HA, et al. Recombinant human adiponectin as a potential protein for treating diabetic tendinopathy promotes tenocyte progenitor cells proliferation and tenogenic differentiation in vitro. Int J Med Sci. 2013 Nov 27;10 (13) :1899-906.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tarbp2 3'UTR Lenti-reporter-Luc Vector
46125084 1.0 µg

Tarbp2 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Cardiogenol C HCl 5mg
A16198-5 5 mg

Cardiogenol C HCl 5mg

Sign In for Pricing
View Details
Human SYNE4 Protein Lysate
MBS8428134-01 0.02 mg

Human SYNE4 Protein Lysate

Sign In for Pricing
View Details
Human SYNE4 Protein Lysate
MBS8428134-02 5x 0.02 mg

Human SYNE4 Protein Lysate

Sign In for Pricing
View Details
Scel Mouse shRNA Lentiviral Particle (Locus ID 64929)
TL503480V 500 µL Each

Scel Mouse shRNA Lentiviral Particle (Locus ID 64929)

Sign In for Pricing
View Details
Lentiviral mouse Tex12 shRNA (UAS) - Lentiviral mouseTex12 shRNA (UAS, GFP) (25)
GTR15128960 1 Vial

Lentiviral mouse Tex12 shRNA (UAS) - Lentiviral mouseTex12 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details