Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Adiponectin/Acrp30, Human (HEK293, His)

Adiponectin/Acrp30 Protein, Human (HEK293, His) could increase cell sensitivity to insulin and can be used as a potential protein for treating diabetic tendinopathy[1].

Product Specifications

Product Name Alternative

Adiponectin/Acrp30 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/adiponectin-acrp30-protein-human-hek293-his.html

Purity

98.0

Smiles

ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN

Molecular Formula

9370 (Gene_ID) Q15848 (E19-N244) (Accession)

Molecular Weight

32-40 kDa

References & Citations

[1]Kumada M, et al. Adiponectin specifically increased tissue inhibitor of metalloproteinase-1 through interleukin-10 expression in human macrophages. Circulation. 2004 May 4;109 (17) :2046-9.|[2]Rothan HA, et al. Recombinant human adiponectin as a potential protein for treating diabetic tendinopathy promotes tenocyte progenitor cells proliferation and tenogenic differentiation in vitro. Int J Med Sci. 2013 Nov 27;10 (13) :1899-906.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tead1 (NM_009346) Mouse Untagged Clone
MC209509 10 µg

Tead1 (NM_009346) Mouse Untagged Clone

Sign In for Pricing
View Details
Agarose Beads with Alkyne Groups
B2013565 5 mL

Agarose Beads with Alkyne Groups

Sign In for Pricing
View Details
2,3,4,5-Tetrahydro-7-methoxy-4- (methyl-d3) -1,4-benzothiazepine
sc-363719 5 mg

2,3,4,5-Tetrahydro-7-methoxy-4- (methyl-d3) -1,4-benzothiazepine

Sign In for Pricing
View Details
Rat Eotaxin 2/CCL24 ELISA Kit
QY-E11950 96 Tests

Rat Eotaxin 2/CCL24 ELISA Kit

Sign In for Pricing
View Details
Recombinant Danio rerio Tetraspanin-9 (tspan9)
MBS7032316-01 0.02 mg

Recombinant Danio rerio Tetraspanin-9 (tspan9)

Sign In for Pricing
View Details
Recombinant Danio rerio Tetraspanin-9 (tspan9)
MBS7032316-02 0.1 mg

Recombinant Danio rerio Tetraspanin-9 (tspan9)

Sign In for Pricing
View Details