Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Adiponectin/Acrp30, Human (HEK293, His)

Adiponectin/Acrp30 Protein, Human (HEK293, His) could increase cell sensitivity to insulin and can be used as a potential protein for treating diabetic tendinopathy[1].

Product Specifications

Product Name Alternative

Adiponectin/Acrp30 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/adiponectin-acrp30-protein-human-hek293-his.html

Purity

98.0

Smiles

ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN

Molecular Formula

9370 (Gene_ID) Q15848 (E19-N244) (Accession)

Molecular Weight

32-40 kDa

References & Citations

[1]Kumada M, et al. Adiponectin specifically increased tissue inhibitor of metalloproteinase-1 through interleukin-10 expression in human macrophages. Circulation. 2004 May 4;109 (17) :2046-9.|[2]Rothan HA, et al. Recombinant human adiponectin as a potential protein for treating diabetic tendinopathy promotes tenocyte progenitor cells proliferation and tenogenic differentiation in vitro. Int J Med Sci. 2013 Nov 27;10 (13) :1899-906.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Retinoic Acid Receptor alpha (RARA) (NM_000964) Human Over-expression Lysate
LH19961V 100 µg

Retinoic Acid Receptor alpha (RARA) (NM_000964) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Guinea pig IL6 protein, N-His Tag
IMP-2930 10 µg

Recombinant Guinea pig IL6 protein, N-His Tag

Sign In for Pricing
View Details
Lentiviral human KDM4C shRNA (UAS) - Lentiviral human KDM4C shRNA (UAS, GFP) (25)
GTR15328007 1 Vial

Lentiviral human KDM4C shRNA (UAS) - Lentiviral human KDM4C shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Lens culinaris agglutinin Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-6439R-BF750 100 µL

Lens culinaris agglutinin Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
CCT4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV689324 1.0 µg DNA

CCT4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Proteasome α3 Antibody
C47456-01 50 μL

Proteasome α3 Antibody

Sign In for Pricing
View Details