Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Adiponectin/Acrp30, Human (HEK293, His)

Adiponectin/Acrp30 Protein, Human (HEK293, His) could increase cell sensitivity to insulin and can be used as a potential protein for treating diabetic tendinopathy[1].

Product Specifications

Product Name Alternative

Adiponectin/Acrp30 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/adiponectin-acrp30-protein-human-hek293-his.html

Purity

98.0

Smiles

ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN

Molecular Formula

9370 (Gene_ID) Q15848 (E19-N244) (Accession)

Molecular Weight

32-40 kDa

References & Citations

[1]Kumada M, et al. Adiponectin specifically increased tissue inhibitor of metalloproteinase-1 through interleukin-10 expression in human macrophages. Circulation. 2004 May 4;109 (17) :2046-9.|[2]Rothan HA, et al. Recombinant human adiponectin as a potential protein for treating diabetic tendinopathy promotes tenocyte progenitor cells proliferation and tenogenic differentiation in vitro. Int J Med Sci. 2013 Nov 27;10 (13) :1899-906.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIK1 Protein Lysate (Mouse) with C-HA Tag
43782034 100 µg

SIK1 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
RORB (RAR-Related Orphan Receptor B, NR1F2, ROR-BETA, RZR-BETA, RZRB, bA133M9.1) (MaxLight 750)
MBS6240379-01 0.1 mL

RORB (RAR-Related Orphan Receptor B, NR1F2, ROR-BETA, RZR-BETA, RZRB, bA133M9.1) (MaxLight 750)

Sign In for Pricing
View Details
RORB (RAR-Related Orphan Receptor B, NR1F2, ROR-BETA, RZR-BETA, RZRB, bA133M9.1) (MaxLight 750)
MBS6240379-02 5x 0.1 mL

RORB (RAR-Related Orphan Receptor B, NR1F2, ROR-BETA, RZR-BETA, RZRB, bA133M9.1) (MaxLight 750)

Sign In for Pricing
View Details
TMEM183A AAV Vector (Rat) (CMV)
46955106 1 µg

TMEM183A AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
Human Aldo-Keto Reductase Family 1 Member B10 (AKR1B10) ELISA Kit
abx250482 96 Well

Human Aldo-Keto Reductase Family 1 Member B10 (AKR1B10) ELISA Kit

Sign In for Pricing
View Details
Mrap (NM_029844) Mouse Tagged ORF Clone Lentiviral Particle
MR200684L3V 200 µL

Mrap (NM_029844) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details