Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Adiponectin/Acrp30, Human (HEK293, His)

Adiponectin/Acrp30 Protein, Human (HEK293, His) could increase cell sensitivity to insulin and can be used as a potential protein for treating diabetic tendinopathy[1].

Product Specifications

Product Name Alternative

Adiponectin/Acrp30 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/adiponectin-acrp30-protein-human-hek293-his.html

Purity

98.0

Smiles

ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN

Molecular Formula

9370 (Gene_ID) Q15848 (E19-N244) (Accession)

Molecular Weight

32-40 kDa

References & Citations

[1]Kumada M, et al. Adiponectin specifically increased tissue inhibitor of metalloproteinase-1 through interleukin-10 expression in human macrophages. Circulation. 2004 May 4;109 (17) :2046-9.|[2]Rothan HA, et al. Recombinant human adiponectin as a potential protein for treating diabetic tendinopathy promotes tenocyte progenitor cells proliferation and tenogenic differentiation in vitro. Int J Med Sci. 2013 Nov 27;10 (13) :1899-906.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRKCI (Protein Kinase C, iota, DXS1179E, MGC26534, PKCI, nPKC-iota) (MaxLight 750)
MBS6240092-01 0.1 mL

PRKCI (Protein Kinase C, iota, DXS1179E, MGC26534, PKCI, nPKC-iota) (MaxLight 750)

Sign In for Pricing
View Details
PRKCI (Protein Kinase C, iota, DXS1179E, MGC26534, PKCI, nPKC-iota) (MaxLight 750)
MBS6240092-02 5x 0.1 mL

PRKCI (Protein Kinase C, iota, DXS1179E, MGC26534, PKCI, nPKC-iota) (MaxLight 750)

Sign In for Pricing
View Details
Dmc1 Rabbit Polyclonal Antibody
E28PT1361 100 µL

Dmc1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse serum amyloid A2, SAA2 ELISA Kit
MBS924232-01 24 Well (LIMIT 1)

Mouse serum amyloid A2, SAA2 ELISA Kit

Sign In for Pricing
View Details
Mouse serum amyloid A2, SAA2 ELISA Kit
MBS924232-02 48 Well

Mouse serum amyloid A2, SAA2 ELISA Kit

Sign In for Pricing
View Details
Mouse serum amyloid A2, SAA2 ELISA Kit
MBS924232-03 96 Well

Mouse serum amyloid A2, SAA2 ELISA Kit

Sign In for Pricing
View Details