Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Adiponectin/Acrp30, Human (HEK293, His)

Adiponectin/Acrp30 Protein, Human (HEK293, His) could increase cell sensitivity to insulin and can be used as a potential protein for treating diabetic tendinopathy[1].

Product Specifications

Product Name Alternative

Adiponectin/Acrp30 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/adiponectin-acrp30-protein-human-hek293-his.html

Purity

98.0

Smiles

ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN

Molecular Formula

9370 (Gene_ID) Q15848 (E19-N244) (Accession)

Molecular Weight

32-40 kDa

References & Citations

[1]Kumada M, et al. Adiponectin specifically increased tissue inhibitor of metalloproteinase-1 through interleukin-10 expression in human macrophages. Circulation. 2004 May 4;109 (17) :2046-9.|[2]Rothan HA, et al. Recombinant human adiponectin as a potential protein for treating diabetic tendinopathy promotes tenocyte progenitor cells proliferation and tenogenic differentiation in vitro. Int J Med Sci. 2013 Nov 27;10 (13) :1899-906.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rapgef6 (NM_175258) Mouse Tagged ORF Clone Lentiviral Particle
MR215350L4V 200 µL

Rapgef6 (NM_175258) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
LHX3 (NM_178138) Human Tagged Lenti ORF Clone
RC216247L1 10 µg

LHX3 (NM_178138) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
HAL Protein Vector (Human) (pPM-C-His)
PV052948 500 ng

HAL Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
TTC39A (NM_001080494) Human Tagged Lenti ORF Clone
RC218567L3 10 µg

TTC39A (NM_001080494) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Lentiviral human NUP188 shRNA (UAS) - Lentiviral human NUP188 shRNA (UAS, GFP) (25)
GTR15128732 1 Vial

Lentiviral human NUP188 shRNA (UAS) - Lentiviral human NUP188 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Human MSRB3 (NM_001031679) AAV Particle
RC208187A1V 250 µL

Human MSRB3 (NM_001031679) AAV Particle

Sign In for Pricing
View Details