Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Adiponectin/Acrp30, Human (HEK293, His)

Adiponectin/Acrp30 Protein, Human (HEK293, His) could increase cell sensitivity to insulin and can be used as a potential protein for treating diabetic tendinopathy[1].

Product Specifications

Product Name Alternative

Adiponectin/Acrp30 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/adiponectin-acrp30-protein-human-hek293-his.html

Purity

98.0

Smiles

ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN

Molecular Formula

9370 (Gene_ID) Q15848 (E19-N244) (Accession)

Molecular Weight

32-40 kDa

References & Citations

[1]Kumada M, et al. Adiponectin specifically increased tissue inhibitor of metalloproteinase-1 through interleukin-10 expression in human macrophages. Circulation. 2004 May 4;109 (17) :2046-9.|[2]Rothan HA, et al. Recombinant human adiponectin as a potential protein for treating diabetic tendinopathy promotes tenocyte progenitor cells proliferation and tenogenic differentiation in vitro. Int J Med Sci. 2013 Nov 27;10 (13) :1899-906.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Abca8b sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3199805 3x 1.0 µg

Abca8b sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
BC022960 3'UTR Luciferase Stable Cell Line
TU102580 1.0 mL

BC022960 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Mouse Monoclonal CEACAM5/CD66e Antibody (SPM506) [Alexa Fluor 488]
NBP2-47975AF488 0.1 mL

Mouse Monoclonal CEACAM5/CD66e Antibody (SPM506) [Alexa Fluor 488]

Sign In for Pricing
View Details
3-Methyl Phenyl Acetic Acid 99.0%
158235-01 25 g

3-Methyl Phenyl Acetic Acid 99.0%

Sign In for Pricing
View Details
3-Methyl Phenyl Acetic Acid 99.0%
158235-02 100 g

3-Methyl Phenyl Acetic Acid 99.0%

Sign In for Pricing
View Details
Human Anti-Filaggrin Antibody AFA ELISA Kit
BG-HUM10092 1 Each

Human Anti-Filaggrin Antibody AFA ELISA Kit

Sign In for Pricing
View Details