Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Adiponectin/Acrp30, Human (HEK293, His)

Adiponectin/Acrp30 Protein, Human (HEK293, His) could increase cell sensitivity to insulin and can be used as a potential protein for treating diabetic tendinopathy[1].

Product Specifications

Product Name Alternative

Adiponectin/Acrp30 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/adiponectin-acrp30-protein-human-hek293-his.html

Purity

98.0

Smiles

ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN

Molecular Formula

9370 (Gene_ID) Q15848 (E19-N244) (Accession)

Molecular Weight

32-40 kDa

References & Citations

[1]Kumada M, et al. Adiponectin specifically increased tissue inhibitor of metalloproteinase-1 through interleukin-10 expression in human macrophages. Circulation. 2004 May 4;109 (17) :2046-9.|[2]Rothan HA, et al. Recombinant human adiponectin as a potential protein for treating diabetic tendinopathy promotes tenocyte progenitor cells proliferation and tenogenic differentiation in vitro. Int J Med Sci. 2013 Nov 27;10 (13) :1899-906.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Cyclin-J, CCNJ ELISA KIT
ELI-10564h 96 Tests

Human Cyclin-J, CCNJ ELISA KIT

Sign In for Pricing
View Details
Ndufaf3 (NM_023247) Mouse Tagged ORF Clone
MR201729 10 µg

Ndufaf3 (NM_023247) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
CXCL9, CT (CXCL9, CMK, MIG, SCYB9, C-X-C motif chemokine 9, Gamma-interferon-induced monokine, Monokine induced by interferon-gamma, Small-inducible cytokine B9) (MaxLight 550) discontinued
034383-ML550 100 µL

CXCL9, CT (CXCL9, CMK, MIG, SCYB9, C-X-C motif chemokine 9, Gamma-interferon-induced monokine, Monokine induced by interferon-gamma, Small-inducible cytokine B9) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Fgfr2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4580707 1.0 µg DNA

Fgfr2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
TRIM24 Protein Vector (Mouse) (pPB-N-His)
PV241451 500 ng

TRIM24 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Indomethacin Acyl Glucuronide
MF-0120173-01 10 mg

Indomethacin Acyl Glucuronide

Sign In for Pricing
View Details