Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Adiponectin/Acrp30, Human (HEK293, His)

Adiponectin/Acrp30 Protein, Human (HEK293, His) could increase cell sensitivity to insulin and can be used as a potential protein for treating diabetic tendinopathy[1].

Product Specifications

Product Name Alternative

Adiponectin/Acrp30 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/adiponectin-acrp30-protein-human-hek293-his.html

Purity

98.0

Smiles

ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN

Molecular Formula

9370 (Gene_ID) Q15848 (E19-N244) (Accession)

Molecular Weight

32-40 kDa

References & Citations

[1]Kumada M, et al. Adiponectin specifically increased tissue inhibitor of metalloproteinase-1 through interleukin-10 expression in human macrophages. Circulation. 2004 May 4;109 (17) :2046-9.|[2]Rothan HA, et al. Recombinant human adiponectin as a potential protein for treating diabetic tendinopathy promotes tenocyte progenitor cells proliferation and tenogenic differentiation in vitro. Int J Med Sci. 2013 Nov 27;10 (13) :1899-906.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal NAC1 Antibody [Alexa Fluor 647]
NBP2-97154AF647 0.1 mL

Rabbit Polyclonal NAC1 Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
RGS4 AAV Vector (Human) (CMV)
39482101 1 µg

RGS4 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
AhR (K32) Rabbit pAb
A24430 50 µL

AhR (K32) Rabbit pAb

Sign In for Pricing
View Details
Recombinant Human TIMP2/TIMP-2 Protein (Fc Tag)
PKSH030472 20 µg

Recombinant Human TIMP2/TIMP-2 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse Alpha-1-antitrypsin 1-1 (Serpina1a)
MBS1230395-01 0.02 mg (E-Coli)

Recombinant Mouse Alpha-1-antitrypsin 1-1 (Serpina1a)

Sign In for Pricing
View Details
Recombinant Mouse Alpha-1-antitrypsin 1-1 (Serpina1a)
MBS1230395-02 0.02 mg (Yeast)

Recombinant Mouse Alpha-1-antitrypsin 1-1 (Serpina1a)

Sign In for Pricing
View Details