Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Adiponectin/Acrp30, Human (HEK293, His)

Adiponectin/Acrp30 Protein, Human (HEK293, His) could increase cell sensitivity to insulin and can be used as a potential protein for treating diabetic tendinopathy[1].

Product Specifications

Product Name Alternative

Adiponectin/Acrp30 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/adiponectin-acrp30-protein-human-hek293-his.html

Purity

98.0

Smiles

ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN

Molecular Formula

9370 (Gene_ID) Q15848 (E19-N244) (Accession)

Molecular Weight

32-40 kDa

References & Citations

[1]Kumada M, et al. Adiponectin specifically increased tissue inhibitor of metalloproteinase-1 through interleukin-10 expression in human macrophages. Circulation. 2004 May 4;109 (17) :2046-9.|[2]Rothan HA, et al. Recombinant human adiponectin as a potential protein for treating diabetic tendinopathy promotes tenocyte progenitor cells proliferation and tenogenic differentiation in vitro. Int J Med Sci. 2013 Nov 27;10 (13) :1899-906.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal ORF1-FL49 Antibody (monoclonal) (M02), Clone: 4E12
AMM03871G 0.1mg

Monoclonal ORF1-FL49 Antibody (monoclonal) (M02), Clone: 4E12

Sign In for Pricing
View Details
Mulberroside F
TBZ2115 10mg

Mulberroside F

Sign In for Pricing
View Details
Mmu-miR-5130 miRNA Agomir
CMN1074-01 5 nmol

Mmu-miR-5130 miRNA Agomir

Sign In for Pricing
View Details
Mmu-miR-5130 miRNA Agomir
CMN1074-02 10 nmol

Mmu-miR-5130 miRNA Agomir

Sign In for Pricing
View Details
Mmu-miR-5130 miRNA Agomir
CMN1074-03 20 nmol

Mmu-miR-5130 miRNA Agomir

Sign In for Pricing
View Details
Macrophage Inflammatory Protein 1 beta (MIP-1b, CCL4) (APC)
MBS6485880-01 0.1 mL

Macrophage Inflammatory Protein 1 beta (MIP-1b, CCL4) (APC)

Sign In for Pricing
View Details