Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Adiponectin/Acrp30, Human (HEK293, His)

Adiponectin/Acrp30 Protein, Human (HEK293, His) could increase cell sensitivity to insulin and can be used as a potential protein for treating diabetic tendinopathy[1].

Product Specifications

Product Name Alternative

Adiponectin/Acrp30 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/adiponectin-acrp30-protein-human-hek293-his.html

Purity

98.0

Smiles

ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN

Molecular Formula

9370 (Gene_ID) Q15848 (E19-N244) (Accession)

Molecular Weight

32-40 kDa

References & Citations

[1]Kumada M, et al. Adiponectin specifically increased tissue inhibitor of metalloproteinase-1 through interleukin-10 expression in human macrophages. Circulation. 2004 May 4;109 (17) :2046-9.|[2]Rothan HA, et al. Recombinant human adiponectin as a potential protein for treating diabetic tendinopathy promotes tenocyte progenitor cells proliferation and tenogenic differentiation in vitro. Int J Med Sci. 2013 Nov 27;10 (13) :1899-906.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human AFP/Alpha-fetoprotein Monoclonal Antibody
E55A11273 100 µL

Human AFP/Alpha-fetoprotein Monoclonal Antibody

Sign In for Pricing
View Details
MYT1 (Membrane-Associated Tyrosine-And Threonine-Specific Cdc2-Inhibitory Kinase, Myt1 Kinase, PKMYT1)
227826 100 µg

MYT1 (Membrane-Associated Tyrosine-And Threonine-Specific Cdc2-Inhibitory Kinase, Myt1 Kinase, PKMYT1)

Sign In for Pricing
View Details
MTMR2 (Myotubularin-related Protein 2, CMT4B, CMT4B1, KIAA1073) (PE)
MBS6158934-01 0.1 mL

MTMR2 (Myotubularin-related Protein 2, CMT4B, CMT4B1, KIAA1073) (PE)

Sign In for Pricing
View Details
MTMR2 (Myotubularin-related Protein 2, CMT4B, CMT4B1, KIAA1073) (PE)
MBS6158934-02 5x 0.1 mL

MTMR2 (Myotubularin-related Protein 2, CMT4B, CMT4B1, KIAA1073) (PE)

Sign In for Pricing
View Details
Slx Mouse shRNA Lentiviral Particle (Locus ID 664829)
TL518851V 500 µL Each

Slx Mouse shRNA Lentiviral Particle (Locus ID 664829)

Sign In for Pricing
View Details
HNRNPA1P30 ORF Vector (Human) (pORF)
ORF021044 1.0 µg DNA

HNRNPA1P30 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details