Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Adiponectin/Acrp30, Human (HEK293, His)

Adiponectin/Acrp30 Protein, Human (HEK293, His) could increase cell sensitivity to insulin and can be used as a potential protein for treating diabetic tendinopathy[1].

Product Specifications

Product Name Alternative

Adiponectin/Acrp30 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/adiponectin-acrp30-protein-human-hek293-his.html

Purity

98.0

Smiles

ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN

Molecular Formula

9370 (Gene_ID) Q15848 (E19-N244) (Accession)

Molecular Weight

32-40 kDa

References & Citations

[1]Kumada M, et al. Adiponectin specifically increased tissue inhibitor of metalloproteinase-1 through interleukin-10 expression in human macrophages. Circulation. 2004 May 4;109 (17) :2046-9.|[2]Rothan HA, et al. Recombinant human adiponectin as a potential protein for treating diabetic tendinopathy promotes tenocyte progenitor cells proliferation and tenogenic differentiation in vitro. Int J Med Sci. 2013 Nov 27;10 (13) :1899-906.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFNG Protein Vector (Human) (pPM-C-HA)
PV020867 500 ng

IFNG Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
VRK1 (Vaccinia-related Kinase 1, Serine/threonine-protein Kinase VRK1, PCH1, PCH1A) (AP) discontinued
135293-AP 100 µL

VRK1 (Vaccinia-related Kinase 1, Serine/threonine-protein Kinase VRK1, PCH1, PCH1A) (AP) discontinued

Sign In for Pricing
View Details
Mouse monoclonal antibody Anti-Human MAML3
MBS120234-01 0.1 mg

Mouse monoclonal antibody Anti-Human MAML3

Sign In for Pricing
View Details
Mouse monoclonal antibody Anti-Human MAML3
MBS120234-02 5x 0.1 mg

Mouse monoclonal antibody Anti-Human MAML3

Sign In for Pricing
View Details
Car7 (NM_001106165) Rat Tagged ORF Clone Lentiviral Particle
RR201286L3V 200 µL

Car7 (NM_001106165) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
ZNF33A, NT (ZNF33A, KIAA0065, KOX31, ZNF11, ZNF11A, ZNF33, Zinc finger protein 33A, Zinc finger and ZAK-associated protein with KRAB domain, Zinc finger protein 11A, Zinc finger protein KOX31) (MaxLight 650) discontinued
044199-ML650 100 µL

ZNF33A, NT (ZNF33A, KIAA0065, KOX31, ZNF11, ZNF11A, ZNF33, Zinc finger protein 33A, Zinc finger and ZAK-associated protein with KRAB domain, Zinc finger protein 11A, Zinc finger protein KOX31) (MaxLight 650) discontinued

Sign In for Pricing
View Details