Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Adiponectin/Acrp30, Human (HEK293, His)

Adiponectin/Acrp30 Protein, Human (HEK293, His) could increase cell sensitivity to insulin and can be used as a potential protein for treating diabetic tendinopathy[1].

Product Specifications

Product Name Alternative

Adiponectin/Acrp30 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/adiponectin-acrp30-protein-human-hek293-his.html

Purity

98.0

Smiles

ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN

Molecular Formula

9370 (Gene_ID) Q15848 (E19-N244) (Accession)

Molecular Weight

32-40 kDa

References & Citations

[1]Kumada M, et al. Adiponectin specifically increased tissue inhibitor of metalloproteinase-1 through interleukin-10 expression in human macrophages. Circulation. 2004 May 4;109 (17) :2046-9.|[2]Rothan HA, et al. Recombinant human adiponectin as a potential protein for treating diabetic tendinopathy promotes tenocyte progenitor cells proliferation and tenogenic differentiation in vitro. Int J Med Sci. 2013 Nov 27;10 (13) :1899-906.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal AMID Antibody [Janelia Fluor 669]
NBP3-18132JF669 0.1 mL

Rabbit Polyclonal AMID Antibody [Janelia Fluor 669]

Sign In for Pricing
View Details
LentimiRa-mmu-miR-134-5p Vector
mm40067 500 ng

LentimiRa-mmu-miR-134-5p Vector

Sign In for Pricing
View Details
Anti Corticoliberin Pab Rat
150100 100 µg

Anti Corticoliberin Pab Rat

Sign In for Pricing
View Details
Apicidin
1601-1 1 mg

Apicidin

Sign In for Pricing
View Details
Mouse Monoclonal Lewis A Blood Group Antigen Antibody (7LE) [Alexa Fluor 350]
NB500-525AF350 0.1 mL

Mouse Monoclonal Lewis A Blood Group Antigen Antibody (7LE) [Alexa Fluor 350]

Sign In for Pricing
View Details
U2af1 AAV siRNA Pooled Vector
48904164 1.0 µg

U2af1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details