Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Adiponectin/Acrp30, Human (HEK293, His)

Adiponectin/Acrp30 Protein, Human (HEK293, His) could increase cell sensitivity to insulin and can be used as a potential protein for treating diabetic tendinopathy[1].

Product Specifications

Product Name Alternative

Adiponectin/Acrp30 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/adiponectin-acrp30-protein-human-hek293-his.html

Purity

98.0

Smiles

ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN

Molecular Formula

9370 (Gene_ID) Q15848 (E19-N244) (Accession)

Molecular Weight

32-40 kDa

References & Citations

[1]Kumada M, et al. Adiponectin specifically increased tissue inhibitor of metalloproteinase-1 through interleukin-10 expression in human macrophages. Circulation. 2004 May 4;109 (17) :2046-9.|[2]Rothan HA, et al. Recombinant human adiponectin as a potential protein for treating diabetic tendinopathy promotes tenocyte progenitor cells proliferation and tenogenic differentiation in vitro. Int J Med Sci. 2013 Nov 27;10 (13) :1899-906.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PFKFB4 (NM_004567) Human Tagged ORF Clone Lentiviral Particle
RC201573L1V 200 µL

PFKFB4 (NM_004567) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
4-Hydroxybenzyl alcohol
108750 100 100 g

4-Hydroxybenzyl alcohol

Sign In for Pricing
View Details
WD repeat domain 5 (WDR5, BIG3, BIG-3, BMP2-induced 3-kb gene protein, SWD3, WD repeat-containing protein 5)
W1006-12 100 µg

WD repeat domain 5 (WDR5, BIG3, BIG-3, BMP2-induced 3-kb gene protein, SWD3, WD repeat-containing protein 5)

Sign In for Pricing
View Details
DBI Polyclonal Antibody
MBS129671-01 0.02 mL

DBI Polyclonal Antibody

Sign In for Pricing
View Details
DBI Polyclonal Antibody
MBS129671-02 0.1 mL

DBI Polyclonal Antibody

Sign In for Pricing
View Details
DBI Polyclonal Antibody
MBS129671-03 5x 0.1 mL

DBI Polyclonal Antibody

Sign In for Pricing
View Details