Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ehrlichia chaffeensis Co-chaperonin GroES (groES)

Product Specifications

Product Name Alternative

10 kDa chaperonin; Chaperonin-10; Cpn10

Abbreviation

Recombinant Ehrlichia chaffeensis groES protein

Gene Name

GroES

UniProt

P42386

Expression Region

1-94aa

Organism

Ehrlichia chaffeensis

Target Sequence

MNLNMLHDNVLIEALEECNSSSPIQLPDSAKKKPTQGKVVAVGPGVYNHSGNILPMTIKVGDVVFYRQWAGNEIEFHEKKYIVMKESDIIAKEA

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Together with the chaperonin GroEL, plays an essential role in assisting protein folding. The GroEL-GroES system forms a nano-cage that allows encapsulation of the non-native substrate proteins and provides a physical environment optimized to promote and accelerate protein folding. GroES binds to the apical surface of the GroEL ring, thereby capping the opening of the GroEL channel.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

17.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (C8/468 + C8/144B), CF405S conjugate, 0.1mg/mL
BNC040750-100 1x 100 µL

CD8 (C8/468 + C8/144B), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Sptbn2 Mouse Gene Knockout Kit (CRISPR)
KN516684 1 Kit

Sptbn2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ap4b1 Mouse Gene Knockout Kit (CRISPR)
KN501371 1 Kit

Ap4b1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Adapter pack for 7ml tubes in Z207-A rotors, 2/pk.
Z326-15-A7 1 Each

Adapter pack for 7ml tubes in Z207-A rotors, 2/pk.

Sign In for Pricing
View Details
Fusion glycoprotein F0 Rabbit Polyclonal Antibody
ER1802-33 100 µL

Fusion glycoprotein F0 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
General Purpose Incubator BIGP-6907
BIGP-6907 1 Unit

General Purpose Incubator BIGP-6907

Sign In for Pricing
View Details