Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nostoc ellipsosporum Cyanovirin-N

Product Specifications

Product Name Alternative

CV-N

Abbreviation

Recombinant Nostoc ellipsosporum Cyanovirin-N protein

UniProt

P81180

Expression Region

1-101aa

Organism

Nostoc ellipsosporum

Target Sequence

LGKFSQTCYNSAIQGSVLTSTCERTNGGYNTSSIDLNSVIENVDGSLKWQPSNFIETCRNTQLAGSSELAAECKTRAQQFVSTKINLDDHIANIDGTLKYE

Tag

C-terminal 6xHis-Myc-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Mannose-binding lectin.Its activity in situ is unknown, however it acts as a viral entry inhibitor, inhibiting HIV-1, HIV-2 and simian immunodeficiency virus (and some other viruses such as feline immunodeficiency virus, measles virus and human herpesvirus) infection and replication. It prevents essential interactions between the envelope glycoprotein and target cell receptors by binding to carbohydrates on viral protein gp120 and possibly by other mechanisms as well. Addition to cells must occur before or shortly after virus addition. It also inhibits cell-to-cell fusion, and virus-to-cell and cell-to-cell transmission of a viral infection. Is remarkably stabile; the protein can withstand multiple freeze-thaw cycles, dissolution in organic solvents, treatment with salt, detergent, H2O2 and boiling without significant loss of anti-HIV activity.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

14.7 kDa

References & Citations

"Discovery of cyanovirin-N, a novel human immunodeficiency virus-inactivating protein that binds viral surface envelope glycoprotein gp120: potential applications to microbicide development." Boyd M.R., Gustafson K.R., McMahon J.B., Shoemaker R.H., O'Keefe B.R., Mori T., Gulakowski R.J., Wu L., Rivera M.I., Laurencot C.M., Currens M.J., Cardellina J.H. II, Buckheit R.W. Jr., Nara P.L., Pannell L.K., Sowder R.C. II, Henderson L.E. Antimicrob. Agents Chemother. 41:1521-1530 (1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PADI4 (NM_012387) Human Untagged Clone
SC324276 10 µg

PADI4 (NM_012387) Human Untagged Clone

Sign In for Pricing
View Details
Goat Protein C ELISA Kit
EGTP0729 96 Tests

Goat Protein C ELISA Kit

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Trefoil Factor 3, Intestinal (TFF3)
MBS2057600-01 0.1 mL

PE-Linked Polyclonal Antibody to Trefoil Factor 3, Intestinal (TFF3)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Trefoil Factor 3, Intestinal (TFF3)
MBS2057600-02 0.2 mL

PE-Linked Polyclonal Antibody to Trefoil Factor 3, Intestinal (TFF3)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Trefoil Factor 3, Intestinal (TFF3)
MBS2057600-03 0.5 mL

PE-Linked Polyclonal Antibody to Trefoil Factor 3, Intestinal (TFF3)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Trefoil Factor 3, Intestinal (TFF3)
MBS2057600-04 1 mL

PE-Linked Polyclonal Antibody to Trefoil Factor 3, Intestinal (TFF3)

Sign In for Pricing
View Details