Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HCC-1/CCL14, Human

HCC-1/CCL14 Protein, Human is a CC chemokine with weak activity against human monocytes, promotes monocyte, eosinophil and T-lymphocyte chemotaxis, and mediates allergic airway inflammation and cancer. HCC-1/CCL14 Protein, Human is a recombinant human HCC-1/CCL14 (T22-N93) expressed by E. coli[1][2].

Product Specifications

Product Name Alternative

HCC-1/CCL14 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hcc-1-ccl14-protein-human.html

Purity

96.0

Smiles

TESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN

Molecular Formula

6358 (Gene_ID) Q16627-1 (T22-N93) (Accession)

Molecular Weight

Approximately 8-10 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Siyao Wang, et al. Glycosylation Regulates N-Terminal Proteolysis and Activity of the Chemokine CCL14. ACS Chem Biol. 2021 Jun 18;16 (6) :973-981.|[2]Mengxuan Zhu, et al. CCL14 serves as a novel prognostic factor and tumor suppressor of HCC by modulating cell cycle and promoting apoptosis. Cell Death Dis. 2019 Oct 22;10 (11) :796.|[3]Natalie J Hannan, et al. CX3CL1 and CCL14 regulate extracellular matrix and adhesion molecules in the trophoblast: potential roles in human embryo implantation. Biol Reprod. 2008 Jul;79 (1) :58-65.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

LPXN antibody
FNab04837 100 µg

LPXN antibody

Ask
View Details
Human anti-human CD5 mAb
A09C23 1 Each

Human anti-human CD5 mAb

Ask
View Details
Porcine Intestinal Epithelial Cell Line-IPEC-J2-eGFP
CC9F44 1x 10^6 Cells/Vial

Porcine Intestinal Epithelial Cell Line-IPEC-J2-eGFP

Ask
View Details
GRK6 (NM_001004106) Human Tagged ORF Clone Lentiviral Particle
RC202464L4V 200 µL

GRK6 (NM_001004106) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
GADD34 Recombinant Protein Antigen
NBP1-89800PEP 0.1 mL

GADD34 Recombinant Protein Antigen

Ask
View Details