Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HCC-1/CCL14, Human

HCC-1/CCL14 Protein, Human is a CC chemokine with weak activity against human monocytes, promotes monocyte, eosinophil and T-lymphocyte chemotaxis, and mediates allergic airway inflammation and cancer. HCC-1/CCL14 Protein, Human is a recombinant human HCC-1/CCL14 (T22-N93) expressed by E. coli[1][2].

Product Specifications

Product Name Alternative

HCC-1/CCL14 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hcc-1-ccl14-protein-human.html

Purity

96.0

Smiles

TESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN

Molecular Formula

6358 (Gene_ID) Q16627-1 (T22-N93) (Accession)

Molecular Weight

Approximately 8-10 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Siyao Wang, et al. Glycosylation Regulates N-Terminal Proteolysis and Activity of the Chemokine CCL14. ACS Chem Biol. 2021 Jun 18;16 (6) :973-981.|[2]Mengxuan Zhu, et al. CCL14 serves as a novel prognostic factor and tumor suppressor of HCC by modulating cell cycle and promoting apoptosis. Cell Death Dis. 2019 Oct 22;10 (11) :796.|[3]Natalie J Hannan, et al. CX3CL1 and CCL14 regulate extracellular matrix and adhesion molecules in the trophoblast: potential roles in human embryo implantation. Biol Reprod. 2008 Jul;79 (1) :58-65.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CD3G Protein (C-Human Fc tag, )
P510860 100 µg

CD3G Protein (C-Human Fc tag, )

Ask
View Details
Recombinant Human Argonaute 4 Protein - (Dry Ice)
H00192670-P01-2ug 2 µg

Recombinant Human Argonaute 4 Protein - (Dry Ice)

Ask
View Details
Recombinant Hepatitis B virus genotype E subtype ayw4 Large envelope protein (S), partial
MBS7085031 Inquire

Recombinant Hepatitis B virus genotype E subtype ayw4 Large envelope protein (S), partial

Ask
View Details
H1f1 Mouse siRNA Oligo Duplex (Locus ID 80838)
SR405629 1 Kit

H1f1 Mouse siRNA Oligo Duplex (Locus ID 80838)

Ask
View Details
Phenanthrene-9-carboxaldehyde
sc-357398A 5 g

Phenanthrene-9-carboxaldehyde

Ask
View Details
Lentiviral mouse 2300009A05Rik shRNA (UAS) - Lentiviral mouse 2300009A05Rik shRNA (UAS, iRFP) (100)
GTR15289347 1 Vial

Lentiviral mouse 2300009A05Rik shRNA (UAS) - Lentiviral mouse 2300009A05Rik shRNA (UAS, iRFP) (100)

Ask
View Details