Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HCC-1/CCL14, Human

HCC-1/CCL14 Protein, Human is a CC chemokine with weak activity against human monocytes, promotes monocyte, eosinophil and T-lymphocyte chemotaxis, and mediates allergic airway inflammation and cancer. HCC-1/CCL14 Protein, Human is a recombinant human HCC-1/CCL14 (T22-N93) expressed by E. coli[1][2].

Product Specifications

Product Name Alternative

HCC-1/CCL14 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hcc-1-ccl14-protein-human.html

Purity

96.0

Smiles

TESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN

Molecular Formula

6358 (Gene_ID) Q16627-1 (T22-N93) (Accession)

Molecular Weight

Approximately 8-10 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Siyao Wang, et al. Glycosylation Regulates N-Terminal Proteolysis and Activity of the Chemokine CCL14. ACS Chem Biol. 2021 Jun 18;16 (6) :973-981.|[2]Mengxuan Zhu, et al. CCL14 serves as a novel prognostic factor and tumor suppressor of HCC by modulating cell cycle and promoting apoptosis. Cell Death Dis. 2019 Oct 22;10 (11) :796.|[3]Natalie J Hannan, et al. CX3CL1 and CCL14 regulate extracellular matrix and adhesion molecules in the trophoblast: potential roles in human embryo implantation. Biol Reprod. 2008 Jul;79 (1) :58-65.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

SEPSECS CRISPRa sgRNA lentivector (set of three targets)(Mouse)
43390124 3x 1.0µg DNA

SEPSECS CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Ask
View Details
SUV39H1 Human shRNA Plasmid Kit (Locus ID 6839)
TL308997 1 Kit

SUV39H1 Human shRNA Plasmid Kit (Locus ID 6839)

Ask
View Details
MRC1, Recombinant, Rat, aa26-1395 (MMR, CD206, CLEC13D, Macrophage Mannose Receptor, MR)
145821 50 µg

MRC1, Recombinant, Rat, aa26-1395 (MMR, CD206, CLEC13D, Macrophage Mannose Receptor, MR)

Ask
View Details
NF1 Antibody
MBS7122206-01 0.05 mg

NF1 Antibody

Ask
View Details
NF1 Antibody
MBS7122206-02 0.1 mg

NF1 Antibody

Ask
View Details
NF1 Antibody
MBS7122206-03 5x 0.1 mg

NF1 Antibody

Ask
View Details