Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HCC-1/CCL14, Human

HCC-1/CCL14 Protein, Human is a CC chemokine with weak activity against human monocytes, promotes monocyte, eosinophil and T-lymphocyte chemotaxis, and mediates allergic airway inflammation and cancer. HCC-1/CCL14 Protein, Human is a recombinant human HCC-1/CCL14 (T22-N93) expressed by E. coli[1][2].

Product Specifications

Product Name Alternative

HCC-1/CCL14 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hcc-1-ccl14-protein-human.html

Purity

96.0

Smiles

TESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN

Molecular Formula

6358 (Gene_ID) Q16627-1 (T22-N93) (Accession)

Molecular Weight

Approximately 8-10 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Siyao Wang, et al. Glycosylation Regulates N-Terminal Proteolysis and Activity of the Chemokine CCL14. ACS Chem Biol. 2021 Jun 18;16 (6) :973-981.|[2]Mengxuan Zhu, et al. CCL14 serves as a novel prognostic factor and tumor suppressor of HCC by modulating cell cycle and promoting apoptosis. Cell Death Dis. 2019 Oct 22;10 (11) :796.|[3]Natalie J Hannan, et al. CX3CL1 and CCL14 regulate extracellular matrix and adhesion molecules in the trophoblast: potential roles in human embryo implantation. Biol Reprod. 2008 Jul;79 (1) :58-65.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CD40 (CD40 Molecule, TNF Receptor Superfamily Member 5, Bp50, CDW40, MGC9013, TNFRSF5, p50) (MaxLight 550)
MBS6216195-01 0.1 mL

CD40 (CD40 Molecule, TNF Receptor Superfamily Member 5, Bp50, CDW40, MGC9013, TNFRSF5, p50) (MaxLight 550)

Ask
View Details
CD40 (CD40 Molecule, TNF Receptor Superfamily Member 5, Bp50, CDW40, MGC9013, TNFRSF5, p50) (MaxLight 550)
MBS6216195-02 5x 0.1 mL

CD40 (CD40 Molecule, TNF Receptor Superfamily Member 5, Bp50, CDW40, MGC9013, TNFRSF5, p50) (MaxLight 550)

Ask
View Details
Lilra6 (NM_011090) Mouse Tagged ORF Clone Lentiviral Particle
MR215407L3V 200 µL

Lilra6 (NM_011090) Mouse Tagged ORF Clone Lentiviral Particle

Ask
View Details
Caspase 2 (ICH1, Nedd2)
NM000890-01 1 g

Caspase 2 (ICH1, Nedd2)

Ask
View Details
Caspase 2 (ICH1, Nedd2)
NM000890-02 5 g

Caspase 2 (ICH1, Nedd2)

Ask
View Details
Caspase 2 (ICH1, Nedd2)
NM000890-03 10 g

Caspase 2 (ICH1, Nedd2)

Ask
View Details