Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HCC-1/CCL14, Human

HCC-1/CCL14 Protein, Human is a CC chemokine with weak activity against human monocytes, promotes monocyte, eosinophil and T-lymphocyte chemotaxis, and mediates allergic airway inflammation and cancer. HCC-1/CCL14 Protein, Human is a recombinant human HCC-1/CCL14 (T22-N93) expressed by E. coli[1][2].

Product Specifications

Product Name Alternative

HCC-1/CCL14 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hcc-1-ccl14-protein-human.html

Purity

96.0

Smiles

TESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN

Molecular Formula

6358 (Gene_ID) Q16627-1 (T22-N93) (Accession)

Molecular Weight

Approximately 8-10 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Siyao Wang, et al. Glycosylation Regulates N-Terminal Proteolysis and Activity of the Chemokine CCL14. ACS Chem Biol. 2021 Jun 18;16 (6) :973-981.|[2]Mengxuan Zhu, et al. CCL14 serves as a novel prognostic factor and tumor suppressor of HCC by modulating cell cycle and promoting apoptosis. Cell Death Dis. 2019 Oct 22;10 (11) :796.|[3]Natalie J Hannan, et al. CX3CL1 and CCL14 regulate extracellular matrix and adhesion molecules in the trophoblast: potential roles in human embryo implantation. Biol Reprod. 2008 Jul;79 (1) :58-65.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rat Neurotrophic Tyrosine Kinase Receptor Type 1 (TrkA) ELISA Kit
MBS8421511-01 1 Kit

Rat Neurotrophic Tyrosine Kinase Receptor Type 1 (TrkA) ELISA Kit

Ask
View Details
Rat Neurotrophic Tyrosine Kinase Receptor Type 1 (TrkA) ELISA Kit
MBS8421511-02 5x 1 Kit

Rat Neurotrophic Tyrosine Kinase Receptor Type 1 (TrkA) ELISA Kit

Ask
View Details
Human ACOT6 knockdown cell line
ABC-KD0161 1 Vial

Human ACOT6 knockdown cell line

Ask
View Details
Phosphatase, Alkaline, Placental, NT (PLAP, Alkaline Phosphatase Placental, Alkaline Phosphatase Placental Type, ALP, ALPP, Glycerophosphatase, PLAP-1, Regan Isozyme) (PE) discontinued
031194-PE 200 µL

Phosphatase, Alkaline, Placental, NT (PLAP, Alkaline Phosphatase Placental, Alkaline Phosphatase Placental Type, ALP, ALPP, Glycerophosphatase, PLAP-1, Regan Isozyme) (PE) discontinued

Ask
View Details
Recombinant Influenza A virus Non-structural protein 1 (NS)
MBS1362017-01 0.02 mg (E-Coli)

Recombinant Influenza A virus Non-structural protein 1 (NS)

Ask
View Details
Recombinant Influenza A virus Non-structural protein 1 (NS)
MBS1362017-02 0.1 mg (E-Coli)

Recombinant Influenza A virus Non-structural protein 1 (NS)

Ask
View Details