Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A4, Human (C/N-His)

The S100A4 protein is a calcium-binding protein involved in angiogenesis, cell differentiation, apoptosis, and autophagy. S100A4 protein interacts with MYH9 to enhance cell motility and invasion. S100A4 also inhibits the pro-apoptotic function of TP53 by reducing its protein levels. S100A4 Protein, Human (C/N-His) is the recombinant human-derived S100A4 protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.

Product Specifications

Product Name Alternative

S100A4 Protein, Human (C/N-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a4-protein-human-c-n-his.html

Purity

97.50

Smiles

MARPLEEALDVIVSTFHKYSGKEGDKFKLNKTELKELLTRELPSFLGKRTDEAAFQKVMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGCPDKEPRKK

Molecular Formula

6275 (Gene_ID) P26447 (M1-K101) (Accession)

Molecular Weight

Approximately 13 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Spata21 (NM_177867) Mouse Tagged Lenti ORF Clone
MR220560L3 10 µg

Spata21 (NM_177867) Mouse Tagged Lenti ORF Clone

Request Quote
View Details
Mouse Igdcc4 qPCR Primer Pair
QM29102S 200 Tests

Mouse Igdcc4 qPCR Primer Pair

Request Quote
View Details
RCC1 shRNA (h) Lentiviral Particles
sc-36399-V 200 µL

RCC1 shRNA (h) Lentiviral Particles

Request Quote
View Details
Proteasome subunit alpha type 6 (PSMA6) Human shRNA Lentiviral Particle (Locus ID 5687)
TL310116V 500 µL Each

Proteasome subunit alpha type 6 (PSMA6) Human shRNA Lentiviral Particle (Locus ID 5687)

Request Quote
View Details