Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A4, Human (C/N-His)

The S100A4 protein is a calcium-binding protein involved in angiogenesis, cell differentiation, apoptosis, and autophagy. S100A4 protein interacts with MYH9 to enhance cell motility and invasion. S100A4 also inhibits the pro-apoptotic function of TP53 by reducing its protein levels. S100A4 Protein, Human (C/N-His) is the recombinant human-derived S100A4 protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.

Product Specifications

Product Name Alternative

S100A4 Protein, Human (C/N-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a4-protein-human-c-n-his.html

Purity

97.50

Smiles

MARPLEEALDVIVSTFHKYSGKEGDKFKLNKTELKELLTRELPSFLGKRTDEAAFQKVMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGCPDKEPRKK

Molecular Formula

6275 (Gene_ID) P26447 (M1-K101) (Accession)

Molecular Weight

Approximately 13 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Annexin A5 (Annexin A5) ELISA Kit
NSL0938r 96 Tests

Rat Annexin A5 (Annexin A5) ELISA Kit

Request Quote
View Details
anti-ENPP4
YF-PA17647 50 ug

anti-ENPP4

Request Quote
View Details
BBC3 Antibody
A15214-50UG 50 µg

BBC3 Antibody

Request Quote
View Details
SIK1 CRISPRa sgRNA lentivector (set of three targets)(Human)
43782121 3x 1.0µg DNA

SIK1 CRISPRa sgRNA lentivector (set of three targets)(Human)

Request Quote
View Details
Mouse Monoclonal HLA G Antibody (G233) [DyLight 680]
NB110-55298FR 0.1 mL

Mouse Monoclonal HLA G Antibody (G233) [DyLight 680]

Request Quote
View Details