Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A4, Human (C/N-His)

The S100A4 protein is a calcium-binding protein involved in angiogenesis, cell differentiation, apoptosis, and autophagy. S100A4 protein interacts with MYH9 to enhance cell motility and invasion. S100A4 also inhibits the pro-apoptotic function of TP53 by reducing its protein levels. S100A4 Protein, Human (C/N-His) is the recombinant human-derived S100A4 protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.

Product Specifications

Product Name Alternative

S100A4 Protein, Human (C/N-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a4-protein-human-c-n-his.html

Purity

97.50

Smiles

MARPLEEALDVIVSTFHKYSGKEGDKFKLNKTELKELLTRELPSFLGKRTDEAAFQKVMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGCPDKEPRKK

Molecular Formula

6275 (Gene_ID) P26447 (M1-K101) (Accession)

Molecular Weight

Approximately 13 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr1448 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4230108 1.0 µg DNA

Olfr1448 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Chicken Diamine Oxidase (DAO) ELISA Kit
EIA05560Ch 1 Kit

Chicken Diamine Oxidase (DAO) ELISA Kit

Sign In for Pricing
View Details
(S)-Coclaurine
MBS3617592-01 5 mg

(S)-Coclaurine

Sign In for Pricing
View Details
(S)-Coclaurine
MBS3617592-02 10 mg

(S)-Coclaurine

Sign In for Pricing
View Details
(S)-Coclaurine
MBS3617592-03 25 mg

(S)-Coclaurine

Sign In for Pricing
View Details
(S)-Coclaurine
MBS3617592-04 50 mg

(S)-Coclaurine

Sign In for Pricing
View Details