Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A4, Human (C/N-His)

The S100A4 protein is a calcium-binding protein involved in angiogenesis, cell differentiation, apoptosis, and autophagy. S100A4 protein interacts with MYH9 to enhance cell motility and invasion. S100A4 also inhibits the pro-apoptotic function of TP53 by reducing its protein levels. S100A4 Protein, Human (C/N-His) is the recombinant human-derived S100A4 protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.

Product Specifications

Product Name Alternative

S100A4 Protein, Human (C/N-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a4-protein-human-c-n-his.html

Purity

97.50

Smiles

MARPLEEALDVIVSTFHKYSGKEGDKFKLNKTELKELLTRELPSFLGKRTDEAAFQKVMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGCPDKEPRKK

Molecular Formula

6275 (Gene_ID) P26447 (M1-K101) (Accession)

Molecular Weight

Approximately 13 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nori® Chicken MMP-12 ELISA Kit
GR114271 96 Well

Nori® Chicken MMP-12 ELISA Kit

Sign In for Pricing
View Details
CLAN (NLR Family CARD Domain-containing Protein 4, CARD, LRR, and NACHT-containing Protein, Clan Protein, Caspase Recruitment Domain-containing Protein 12, Ice Protease-activating Factor, Ipaf, NLRC4, CARD12, CLAN1, IPAF, UNQ6189/PRO20215) discontinued
C5820-01C 50 µL

CLAN (NLR Family CARD Domain-containing Protein 4, CARD, LRR, and NACHT-containing Protein, Clan Protein, Caspase Recruitment Domain-containing Protein 12, Ice Protease-activating Factor, Ipaf, NLRC4, CARD12, CLAN1, IPAF, UNQ6189/PRO20215) discontinued

Sign In for Pricing
View Details
LIPG Mouse Monoclonal Antibody [Clone ID: OTI8F8]
CF501041 100 µg

LIPG Mouse Monoclonal Antibody [Clone ID: OTI8F8]

Sign In for Pricing
View Details
Hoechst 33342
S01YF-0223-KX456 1 Vial

Hoechst 33342

Sign In for Pricing
View Details
Plekhd1 (NM_001177503) Mouse Untagged Clone
MC217199 10 µg

Plekhd1 (NM_001177503) Mouse Untagged Clone

Sign In for Pricing
View Details
KRT35 (HHA5, HKA5, KRTHA5, Keratin, Type I Cuticular Ha5, Hair Keratin, Type I Ha5, Keratin-35) (MaxLight 650)
MBS6383935-01 0.1 mL

KRT35 (HHA5, HKA5, KRTHA5, Keratin, Type I Cuticular Ha5, Hair Keratin, Type I Ha5, Keratin-35) (MaxLight 650)

Sign In for Pricing
View Details