Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A4, Human (C/N-His)

The S100A4 protein is a calcium-binding protein involved in angiogenesis, cell differentiation, apoptosis, and autophagy. S100A4 protein interacts with MYH9 to enhance cell motility and invasion. S100A4 also inhibits the pro-apoptotic function of TP53 by reducing its protein levels. S100A4 Protein, Human (C/N-His) is the recombinant human-derived S100A4 protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.

Product Specifications

Product Name Alternative

S100A4 Protein, Human (C/N-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a4-protein-human-c-n-his.html

Purity

97.50

Smiles

MARPLEEALDVIVSTFHKYSGKEGDKFKLNKTELKELLTRELPSFLGKRTDEAAFQKVMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGCPDKEPRKK

Molecular Formula

6275 (Gene_ID) P26447 (M1-K101) (Accession)

Molecular Weight

Approximately 13 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Granzyme M (GZMM) ELISA Kit
RDR-GZMM-p-48Tests 48 Tests

Porcine Granzyme M (GZMM) ELISA Kit

Sign In for Pricing
View Details
YY1AP1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV716891 1.0 µg DNA

YY1AP1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Bmp4 (NM_007554) Mouse Tagged Lenti ORF Clone
MR225467L4 10 µg

Bmp4 (NM_007554) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
MINA Recombinant Protein (Rat)
RP211778 100 µg

MINA Recombinant Protein (Rat)

Sign In for Pricing
View Details
Human RAB5A Protein Lysate
MBS8418214-01 0.02 mg

Human RAB5A Protein Lysate

Sign In for Pricing
View Details
Human RAB5A Protein Lysate
MBS8418214-02 5x 0.02 mg

Human RAB5A Protein Lysate

Sign In for Pricing
View Details