Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A4, Human (C/N-His)

The S100A4 protein is a calcium-binding protein involved in angiogenesis, cell differentiation, apoptosis, and autophagy. S100A4 protein interacts with MYH9 to enhance cell motility and invasion. S100A4 also inhibits the pro-apoptotic function of TP53 by reducing its protein levels. S100A4 Protein, Human (C/N-His) is the recombinant human-derived S100A4 protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.

Product Specifications

Product Name Alternative

S100A4 Protein, Human (C/N-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a4-protein-human-c-n-his.html

Purity

97.50

Smiles

MARPLEEALDVIVSTFHKYSGKEGDKFKLNKTELKELLTRELPSFLGKRTDEAAFQKVMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGCPDKEPRKK

Molecular Formula

6275 (Gene_ID) P26447 (M1-K101) (Accession)

Molecular Weight

Approximately 13 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TXNRD1 Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-61558R-BF405-01 20 µL

TXNRD1 Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
TXNRD1 Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-61558R-BF405-02 100 µL

TXNRD1 Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Human GID8 Knockout HEK293T cell line
GTR15414828 1 Vial

Human GID8 Knockout HEK293T cell line

Sign In for Pricing
View Details
FGFR2 N549K Recombinant Human Active Protein Kinase
HY-E70823 1 Each

FGFR2 N549K Recombinant Human Active Protein Kinase

Sign In for Pricing
View Details
Human Streptococcus II (STRII) ELISA Kit
MBS9916303-01 48 Well

Human Streptococcus II (STRII) ELISA Kit

Sign In for Pricing
View Details
Human Streptococcus II (STRII) ELISA Kit
MBS9916303-02 96 Well

Human Streptococcus II (STRII) ELISA Kit

Sign In for Pricing
View Details