Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A4, Human (C/N-His)

The S100A4 protein is a calcium-binding protein involved in angiogenesis, cell differentiation, apoptosis, and autophagy. S100A4 protein interacts with MYH9 to enhance cell motility and invasion. S100A4 also inhibits the pro-apoptotic function of TP53 by reducing its protein levels. S100A4 Protein, Human (C/N-His) is the recombinant human-derived S100A4 protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.

Product Specifications

Product Name Alternative

S100A4 Protein, Human (C/N-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a4-protein-human-c-n-his.html

Purity

97.50

Smiles

MARPLEEALDVIVSTFHKYSGKEGDKFKLNKTELKELLTRELPSFLGKRTDEAAFQKVMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGCPDKEPRKK

Molecular Formula

6275 (Gene_ID) P26447 (M1-K101) (Accession)

Molecular Weight

Approximately 13 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Krt77 (NM_001003667) Mouse Tagged Lenti ORF Clone
MR224414L3 10 µg

Krt77 (NM_001003667) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mmu-miR-466i-5p miRNA Antagomir
CIN1001-01 10 nmol

Mmu-miR-466i-5p miRNA Antagomir

Sign In for Pricing
View Details
Mmu-miR-466i-5p miRNA Antagomir
CIN1001-02 20 nmol

Mmu-miR-466i-5p miRNA Antagomir

Sign In for Pricing
View Details
VWC2 Protein Vector (Rat) (pPB-C-His)
PV316186 500 ng

VWC2 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Human Olfactory receptor 5K2 (OR5K2) ELISA Kit
abx537074 96 Tests

Human Olfactory receptor 5K2 (OR5K2) ELISA Kit

Sign In for Pricing
View Details
ADAMTS3 (NM_014243) Human Tagged ORF Clone Lentiviral Particle
RC211602L3V 200 µL

ADAMTS3 (NM_014243) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details