Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A4, Human (C/N-His)

The S100A4 protein is a calcium-binding protein involved in angiogenesis, cell differentiation, apoptosis, and autophagy. S100A4 protein interacts with MYH9 to enhance cell motility and invasion. S100A4 also inhibits the pro-apoptotic function of TP53 by reducing its protein levels. S100A4 Protein, Human (C/N-His) is the recombinant human-derived S100A4 protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.

Product Specifications

Product Name Alternative

S100A4 Protein, Human (C/N-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a4-protein-human-c-n-his.html

Purity

97.50

Smiles

MARPLEEALDVIVSTFHKYSGKEGDKFKLNKTELKELLTRELPSFLGKRTDEAAFQKVMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGCPDKEPRKK

Molecular Formula

6275 (Gene_ID) P26447 (M1-K101) (Accession)

Molecular Weight

Approximately 13 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-DLK1 antibody
STJ28661 100 µl

Anti-DLK1 antibody

Sign In for Pricing
View Details
Human Alkaline Phosphatase (ALP) AssayLite™ Antibody (PerCP Conjugate)
32928-05171 5x 30 µg

Human Alkaline Phosphatase (ALP) AssayLite™ Antibody (PerCP Conjugate)

Sign In for Pricing
View Details
DEPDC6 (DEP Domain-containing mTOR-interacting Protein, DEP Domain-containing Protein 6, DEPTOR, DKFZp564B1778, FLJ12341, FLJ12428, FLJ13854) (MaxLight 490)
MBS6376024-01 0.1 mL

DEPDC6 (DEP Domain-containing mTOR-interacting Protein, DEP Domain-containing Protein 6, DEPTOR, DKFZp564B1778, FLJ12341, FLJ12428, FLJ13854) (MaxLight 490)

Sign In for Pricing
View Details
DEPDC6 (DEP Domain-containing mTOR-interacting Protein, DEP Domain-containing Protein 6, DEPTOR, DKFZp564B1778, FLJ12341, FLJ12428, FLJ13854) (MaxLight 490)
MBS6376024-02 5x 0.1 mL

DEPDC6 (DEP Domain-containing mTOR-interacting Protein, DEP Domain-containing Protein 6, DEPTOR, DKFZp564B1778, FLJ12341, FLJ12428, FLJ13854) (MaxLight 490)

Sign In for Pricing
View Details
Mouse Monoclonal MICA Antibody (MICA/4443) [DyLight 650]
NBP3-14212C 0.1 mL

Mouse Monoclonal MICA Antibody (MICA/4443) [DyLight 650]

Sign In for Pricing
View Details
Human Slit3 (Slit Homolog 3) ELISA Kit
MBS8804545-01 48 Well

Human Slit3 (Slit Homolog 3) ELISA Kit

Sign In for Pricing
View Details