Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A4, Human (C/N-His)

The S100A4 protein is a calcium-binding protein involved in angiogenesis, cell differentiation, apoptosis, and autophagy. S100A4 protein interacts with MYH9 to enhance cell motility and invasion. S100A4 also inhibits the pro-apoptotic function of TP53 by reducing its protein levels. S100A4 Protein, Human (C/N-His) is the recombinant human-derived S100A4 protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.

Product Specifications

Product Name Alternative

S100A4 Protein, Human (C/N-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a4-protein-human-c-n-his.html

Purity

97.50

Smiles

MARPLEEALDVIVSTFHKYSGKEGDKFKLNKTELKELLTRELPSFLGKRTDEAAFQKVMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGCPDKEPRKK

Molecular Formula

6275 (Gene_ID) P26447 (M1-K101) (Accession)

Molecular Weight

Approximately 13 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Horse Apolipoprotein A1 Binding Protein (APOA1BP) Antibody Pair Kit (with Standard)
MBS2102718-01 5x 96 Tests

Horse Apolipoprotein A1 Binding Protein (APOA1BP) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Horse Apolipoprotein A1 Binding Protein (APOA1BP) Antibody Pair Kit (with Standard)
MBS2102718-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Horse Apolipoprotein A1 Binding Protein (APOA1BP) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Horse Apolipoprotein A1 Binding Protein (APOA1BP) Antibody Pair Kit (with Standard)
MBS2102718-03 10x 96 Tests

Horse Apolipoprotein A1 Binding Protein (APOA1BP) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Horse Apolipoprotein A1 Binding Protein (APOA1BP) Antibody Pair Kit (with Standard)
MBS2102718-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Horse Apolipoprotein A1 Binding Protein (APOA1BP) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
HEBP2 Recombinant Protein (Rat)
RP204401 100 µg

HEBP2 Recombinant Protein (Rat)

Sign In for Pricing
View Details
ATP6V1A (V-type Proton ATPase Catalytic Subunit A, V-ATPase Subunit A, V-ATPase 69kD Subunit, Vacuolar ATPase Isoform VA68, Vacuolar Proton Pump Subunit alpha, ATP6A1, ATP6V1A1, VPP2) (MaxLight 650)
123721-ML650 100 µL

ATP6V1A (V-type Proton ATPase Catalytic Subunit A, V-ATPase Subunit A, V-ATPase 69kD Subunit, Vacuolar ATPase Isoform VA68, Vacuolar Proton Pump Subunit alpha, ATP6A1, ATP6V1A1, VPP2) (MaxLight 650)

Sign In for Pricing
View Details