S100A4, Human (C/N-His)
The S100A4 protein is a calcium-binding protein involved in angiogenesis, cell differentiation, apoptosis, and autophagy. S100A4 protein interacts with MYH9 to enhance cell motility and invasion. S100A4 also inhibits the pro-apoptotic function of TP53 by reducing its protein levels. S100A4 Protein, Human (C/N-His) is the recombinant human-derived S100A4 protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.
Product Specifications
Product Name Alternative
S100A4 Protein, Human (C/N-His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/s100a4-protein-human-c-n-his.html
Purity
97.50
Smiles
MARPLEEALDVIVSTFHKYSGKEGDKFKLNKTELKELLTRELPSFLGKRTDEAAFQKVMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGCPDKEPRKK
Molecular Formula
6275 (Gene_ID) P26447 (M1-K101) (Accession)
Molecular Weight
Approximately 13 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
ANR52, NT (ANKRD52, Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C, Ankyrin repeat domain-containing protein 52) (FITC)
ANR52, NT (ANKRD52, Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C, Ankyrin repeat domain-containing protein 52) (FITC)
IFNa2 (Interferon Alpha 2, IFNA2A, IFNA2B, IFNA2C, LeIF A, Alpha-2a Interferon, Interferon Alpha 2b, Interferon Alpha A)
