Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A4, Human (C/N-His)

The S100A4 protein is a calcium-binding protein involved in angiogenesis, cell differentiation, apoptosis, and autophagy. S100A4 protein interacts with MYH9 to enhance cell motility and invasion. S100A4 also inhibits the pro-apoptotic function of TP53 by reducing its protein levels. S100A4 Protein, Human (C/N-His) is the recombinant human-derived S100A4 protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.

Product Specifications

Product Name Alternative

S100A4 Protein, Human (C/N-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a4-protein-human-c-n-his.html

Purity

97.50

Smiles

MARPLEEALDVIVSTFHKYSGKEGDKFKLNKTELKELLTRELPSFLGKRTDEAAFQKVMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGCPDKEPRKK

Molecular Formula

6275 (Gene_ID) P26447 (M1-K101) (Accession)

Molecular Weight

Approximately 13 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mid1ip1 (NM_206950) Rat Untagged Clone
RN215492 10 µg

Mid1ip1 (NM_206950) Rat Untagged Clone

Sign In for Pricing
View Details
YY1 associated factor 2 (YAF2) (NM_005748) Human Over-expression Lysate
LS010138-100ug 100 µg

YY1 associated factor 2 (YAF2) (NM_005748) Human Over-expression Lysate

Sign In for Pricing
View Details
APC anti-human IgD
GT12461 25 Tests

APC anti-human IgD

Sign In for Pricing
View Details
SKP1P2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2154105 3x 1.0 µg

SKP1P2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
RPL31 AAV Vector (Rat) (CMV)
41347106 1 µg

RPL31 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
LDB1 (CLIM2, LDB-1, LIM Domain-binding Protein 1, Carboxyl-terminal LIM Domain-binding Protein 2, CLIM-2, LIM Domain-binding Factor CLIM2, hLdb1, Nuclear LIM Interactor) (MaxLight 650)
MBS6222962-01 0.1 mL

LDB1 (CLIM2, LDB-1, LIM Domain-binding Protein 1, Carboxyl-terminal LIM Domain-binding Protein 2, CLIM-2, LIM Domain-binding Factor CLIM2, hLdb1, Nuclear LIM Interactor) (MaxLight 650)

Sign In for Pricing
View Details