Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A4, Human (C/N-His)

The S100A4 protein is a calcium-binding protein involved in angiogenesis, cell differentiation, apoptosis, and autophagy. S100A4 protein interacts with MYH9 to enhance cell motility and invasion. S100A4 also inhibits the pro-apoptotic function of TP53 by reducing its protein levels. S100A4 Protein, Human (C/N-His) is the recombinant human-derived S100A4 protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.

Product Specifications

Product Name Alternative

S100A4 Protein, Human (C/N-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a4-protein-human-c-n-his.html

Purity

97.50

Smiles

MARPLEEALDVIVSTFHKYSGKEGDKFKLNKTELKELLTRELPSFLGKRTDEAAFQKVMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGCPDKEPRKK

Molecular Formula

6275 (Gene_ID) P26447 (M1-K101) (Accession)

Molecular Weight

Approximately 13 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUP210 siRNA (Mouse)
CRM5541-01 15 nmol

NUP210 siRNA (Mouse)

Sign In for Pricing
View Details
NUP210 siRNA (Mouse)
CRM5541-02 30 nmol

NUP210 siRNA (Mouse)

Sign In for Pricing
View Details
KRTAP8P1 CRISPR Knock Out 293T Cell Line (Human)
60970141 1x 10^6 Cells / 1.0 mL

KRTAP8P1 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
hsa-miR-210 miRNA Inhibitor
MIH01534 2x 5.0 nmol

hsa-miR-210 miRNA Inhibitor

Sign In for Pricing
View Details
p90RSK antibody (Thr348)
70R-37185 100 ug

p90RSK antibody (Thr348)

Sign In for Pricing
View Details
Recombinant Mouse CES5 / Carboxylesterase-5 Protein (His tag)
E53A07338 50 µg

Recombinant Mouse CES5 / Carboxylesterase-5 Protein (His tag)

Sign In for Pricing
View Details