Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A4, Human (C/N-His)

The S100A4 protein is a calcium-binding protein involved in angiogenesis, cell differentiation, apoptosis, and autophagy. S100A4 protein interacts with MYH9 to enhance cell motility and invasion. S100A4 also inhibits the pro-apoptotic function of TP53 by reducing its protein levels. S100A4 Protein, Human (C/N-His) is the recombinant human-derived S100A4 protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.

Product Specifications

Product Name Alternative

S100A4 Protein, Human (C/N-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a4-protein-human-c-n-his.html

Purity

97.50

Smiles

MARPLEEALDVIVSTFHKYSGKEGDKFKLNKTELKELLTRELPSFLGKRTDEAAFQKVMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGCPDKEPRKK

Molecular Formula

6275 (Gene_ID) P26447 (M1-K101) (Accession)

Molecular Weight

Approximately 13 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acetylcholine (ACH) BioAssayTM ELISA Kit discontinued
529898 96 Tests

Acetylcholine (ACH) BioAssayTM ELISA Kit discontinued

Sign In for Pricing
View Details
B2M Antibody, HRP conjugated
A41308-50UG 50 µg

B2M Antibody, HRP conjugated

Sign In for Pricing
View Details
PCMV-KLF10 (human) -3xFLAG-Neo
BZ56953 1 Vial

PCMV-KLF10 (human) -3xFLAG-Neo

Sign In for Pricing
View Details
Recombinant Guinea pig Alpha-2A adrenergic receptor (ADRA2A), partial
MBS7084024 Inquire

Recombinant Guinea pig Alpha-2A adrenergic receptor (ADRA2A), partial

Sign In for Pricing
View Details
Rhesus Macaque TNF-alpha Affinity Purified Polyclonal Ab
AF1070-SP 25 µg

Rhesus Macaque TNF-alpha Affinity Purified Polyclonal Ab

Sign In for Pricing
View Details
Duffy/FY/DARC (Biotin)
551292 100 µg

Duffy/FY/DARC (Biotin)

Sign In for Pricing
View Details