Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A4, Human (C/N-His)

The S100A4 protein is a calcium-binding protein involved in angiogenesis, cell differentiation, apoptosis, and autophagy. S100A4 protein interacts with MYH9 to enhance cell motility and invasion. S100A4 also inhibits the pro-apoptotic function of TP53 by reducing its protein levels. S100A4 Protein, Human (C/N-His) is the recombinant human-derived S100A4 protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.

Product Specifications

Product Name Alternative

S100A4 Protein, Human (C/N-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a4-protein-human-c-n-his.html

Purity

97.50

Smiles

MARPLEEALDVIVSTFHKYSGKEGDKFKLNKTELKELLTRELPSFLGKRTDEAAFQKVMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGCPDKEPRKK

Molecular Formula

6275 (Gene_ID) P26447 (M1-K101) (Accession)

Molecular Weight

Approximately 13 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tyr ORF Vector (Mouse) (pORF)
ORF060829 1.0 µg DNA

Tyr ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
PRLR Recombinant Antibody, APC-Cy7 Conjugated
bsm-61624R-APC-Cy7 100 µL

PRLR Recombinant Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
Ephrin A3 Antibody
MBS5314306-01 0.1 mL

Ephrin A3 Antibody

Sign In for Pricing
View Details
Ephrin A3 Antibody
MBS5314306-02 5x 0.1 mL

Ephrin A3 Antibody

Sign In for Pricing
View Details
TSSK4 Antibody
MBS9606017-01 0.1 mL

TSSK4 Antibody

Sign In for Pricing
View Details
TSSK4 Antibody
MBS9606017-02 0.2 mL

TSSK4 Antibody

Sign In for Pricing
View Details