Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A4, Human (C/N-His)

The S100A4 protein is a calcium-binding protein involved in angiogenesis, cell differentiation, apoptosis, and autophagy. S100A4 protein interacts with MYH9 to enhance cell motility and invasion. S100A4 also inhibits the pro-apoptotic function of TP53 by reducing its protein levels. S100A4 Protein, Human (C/N-His) is the recombinant human-derived S100A4 protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.

Product Specifications

Product Name Alternative

S100A4 Protein, Human (C/N-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a4-protein-human-c-n-his.html

Purity

97.50

Smiles

MARPLEEALDVIVSTFHKYSGKEGDKFKLNKTELKELLTRELPSFLGKRTDEAAFQKVMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGCPDKEPRKK

Molecular Formula

6275 (Gene_ID) P26447 (M1-K101) (Accession)

Molecular Weight

Approximately 13 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ZNF114 (NM_001301062) Human Tagged ORF Clone
RG237875 10 µg

ZNF114 (NM_001301062) Human Tagged ORF Clone

Ask
View Details
Insulin Like Growth Factor 1 (IGF1) Polyclonal Antibody
CAU37257-01 100 µL

Insulin Like Growth Factor 1 (IGF1) Polyclonal Antibody

Ask
View Details
Insulin Like Growth Factor 1 (IGF1) Polyclonal Antibody
CAU37257-02 200 µL

Insulin Like Growth Factor 1 (IGF1) Polyclonal Antibody

Ask
View Details
Insulin Like Growth Factor 1 (IGF1) Polyclonal Antibody
CAU37257-03 1 mL

Insulin Like Growth Factor 1 (IGF1) Polyclonal Antibody

Ask
View Details
APOBEC3F, NT (APOBEC3F, DNA dC->dU-editing enzyme APOBEC-3F, Apolipoprotein B mRNA-editing enzyme catalytic polypeptide-like 3F) (MaxLight 750) discontinued
031983-ML750 100 µL

APOBEC3F, NT (APOBEC3F, DNA dC->dU-editing enzyme APOBEC-3F, Apolipoprotein B mRNA-editing enzyme catalytic polypeptide-like 3F) (MaxLight 750) discontinued

Ask
View Details
ABflo® 594 Rabbit anti-Human CD13/ANPEP mAb
A24187-01 50 Tests

ABflo® 594 Rabbit anti-Human CD13/ANPEP mAb

Ask
View Details