Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A4, Human (C/N-His)

The S100A4 protein is a calcium-binding protein involved in angiogenesis, cell differentiation, apoptosis, and autophagy. S100A4 protein interacts with MYH9 to enhance cell motility and invasion. S100A4 also inhibits the pro-apoptotic function of TP53 by reducing its protein levels. S100A4 Protein, Human (C/N-His) is the recombinant human-derived S100A4 protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.

Product Specifications

Product Name Alternative

S100A4 Protein, Human (C/N-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a4-protein-human-c-n-his.html

Purity

97.50

Smiles

MARPLEEALDVIVSTFHKYSGKEGDKFKLNKTELKELLTRELPSFLGKRTDEAAFQKVMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGCPDKEPRKK

Molecular Formula

6275 (Gene_ID) P26447 (M1-K101) (Accession)

Molecular Weight

Approximately 13 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Teddm1a (NM_178244) Mouse Tagged ORF Clone
MG218551 10 µg

Teddm1a (NM_178244) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Herpes Simplex Virus II, Glycoprotein B (HSV II) (MaxLight 650) discontinued
H2033-31B-ML650 100 µL

Herpes Simplex Virus II, Glycoprotein B (HSV II) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Porcine Chromogranin B (CHGB) Antibody Pair Kit (with Standard)
MBS2102131-01 5x 96 Tests

Porcine Chromogranin B (CHGB) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Porcine Chromogranin B (CHGB) Antibody Pair Kit (with Standard)
MBS2102131-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Porcine Chromogranin B (CHGB) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Porcine Chromogranin B (CHGB) Antibody Pair Kit (with Standard)
MBS2102131-03 10x 96 Tests

Porcine Chromogranin B (CHGB) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Porcine Chromogranin B (CHGB) Antibody Pair Kit (with Standard)
MBS2102131-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Porcine Chromogranin B (CHGB) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details