Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A4, Human (C/N-His)

The S100A4 protein is a calcium-binding protein involved in angiogenesis, cell differentiation, apoptosis, and autophagy. S100A4 protein interacts with MYH9 to enhance cell motility and invasion. S100A4 also inhibits the pro-apoptotic function of TP53 by reducing its protein levels. S100A4 Protein, Human (C/N-His) is the recombinant human-derived S100A4 protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.

Product Specifications

Product Name Alternative

S100A4 Protein, Human (C/N-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a4-protein-human-c-n-his.html

Purity

97.50

Smiles

MARPLEEALDVIVSTFHKYSGKEGDKFKLNKTELKELLTRELPSFLGKRTDEAAFQKVMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGCPDKEPRKK

Molecular Formula

6275 (Gene_ID) P26447 (M1-K101) (Accession)

Molecular Weight

Approximately 13 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MID1IP1 (NM_021242) AAV Particle
RC203444A1V 250 µL

Human MID1IP1 (NM_021242) AAV Particle

Sign In for Pricing
View Details
TTC8 Recombinant Protein (Human)
RP033337 100 µg

TTC8 Recombinant Protein (Human)

Sign In for Pricing
View Details
H mgA2 Rabbit Polyclonal Antibody
E28PN2442 100 µL

H mgA2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Fuchsin Acid 1% w/v Solution
01260 00125 125 mL

Fuchsin Acid 1% w/v Solution

Sign In for Pricing
View Details
CLEC4D Rabbit pAb
E45R24915N-100 100 µL

CLEC4D Rabbit pAb

Sign In for Pricing
View Details
Rabbit Polyclonal UBE2D4/Ubch5d Antibody [Alexa Fluor 488]
NBP3-00095AF488 0.1 mL

Rabbit Polyclonal UBE2D4/Ubch5d Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details