Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A4, Human (C/N-His)

The S100A4 protein is a calcium-binding protein involved in angiogenesis, cell differentiation, apoptosis, and autophagy. S100A4 protein interacts with MYH9 to enhance cell motility and invasion. S100A4 also inhibits the pro-apoptotic function of TP53 by reducing its protein levels. S100A4 Protein, Human (C/N-His) is the recombinant human-derived S100A4 protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.

Product Specifications

Product Name Alternative

S100A4 Protein, Human (C/N-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a4-protein-human-c-n-his.html

Purity

97.50

Smiles

MARPLEEALDVIVSTFHKYSGKEGDKFKLNKTELKELLTRELPSFLGKRTDEAAFQKVMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGCPDKEPRKK

Molecular Formula

6275 (Gene_ID) P26447 (M1-K101) (Accession)

Molecular Weight

Approximately 13 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cbr4 (NM_182672) Rat Untagged Clone
RN214759 10 µg

Cbr4 (NM_182672) Rat Untagged Clone

Request Quote
View Details
Goat anti-IL-17B (aa77-89) Antibody
MBS423463-01 0.1 mg

Goat anti-IL-17B (aa77-89) Antibody

Request Quote
View Details
Goat anti-IL-17B (aa77-89) Antibody
MBS423463-02 5x 0.1 mg

Goat anti-IL-17B (aa77-89) Antibody

Request Quote
View Details
Pkp4 Rat siRNA Oligo Duplex (Locus ID 295625)
SR514035 1 Kit

Pkp4 Rat siRNA Oligo Duplex (Locus ID 295625)

Request Quote
View Details
MIP-3alpha (Macrophage Inflammatory Protein 3 Alpha) BioAssayTM ELISA Kit (Human) discontinued
383680 96 Tests

MIP-3alpha (Macrophage Inflammatory Protein 3 Alpha) BioAssayTM ELISA Kit (Human) discontinued

Request Quote
View Details
Blvra (NM_053850) Rat Untagged Clone
RN212758 10 µg

Blvra (NM_053850) Rat Untagged Clone

Request Quote
View Details