Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Erythropoietin (EPO) (Active)

Product Specifications

Product Name Alternative

Erythropoietin; Epoetin

Abbreviation

Recombinant Human EPO protein (Active)

Gene Name

EPO

UniProt

P01588

Expression Region

28-193aa

Organism

Homo sapiens (Human)

Target Sequence

APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR

Tag

C-terminal 10xHis-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

Hormone involved in the regulation of erythrocyte proliferation and differentiation and the maintenance of a physiological level of circulating erythrocyte mass. Binds to EPOR leading to EPOR dimerization and JAK2 activation thereby activating specific downstream effectors, including STAT1 and STAT3.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

The ED50 as determined by the dose-dependent stimulation of the proliferation of TF-1 cells is 0.3534 to 0.7096 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

21.2 kDa

References & Citations

Serum Erythropoietin level in anemia of elderly with unclear etiology. Seong J.Y., Shin D.Y., Byun J.M., Koh Y., Hong J., Kim I., Yoon S.S. Sci Rep 13:15902-15902 (2023)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD31 / PECAM-1 (C31.3), 1mg/mL
BNUM0049-50 1x 50 µL

CD31 / PECAM-1 (C31.3), 1mg/mL

Sign In for Pricing
View Details
NUDT10 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2G8]
TA804113BM 100 µL

NUDT10 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2G8]

Sign In for Pricing
View Details
MICB Mouse Monoclonal Antibody [Clone ID: OTI3E6]
CF813499 100 µg

MICB Mouse Monoclonal Antibody [Clone ID: OTI3E6]

Sign In for Pricing
View Details
Recombinant Human Integrin beta 1 Protein (His Tag)
PKSH031971 50 µg

Recombinant Human Integrin beta 1 Protein (His Tag)

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS649716 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
Recombinant Mouse PGLYRP1/PGRP-S Protein (His Tag)
PKSM040857 100 µg

Recombinant Mouse PGLYRP1/PGRP-S Protein (His Tag)

Sign In for Pricing
View Details