Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Leptin, Carassius auratus (P.pastoris, His)

Leptin protein plays a pivotal role in regulating energy balance and body weight. It binds to its receptor, LEPR, in various tissues, activating signaling pathways that regulate energy homeostasis. Leptin Protein, Carassius auratus (P.pastoris, His) is the recombinant Leptin protein, expressed by P. pastoris , with N-8*His labeled tag.

Product Specifications

Product Name Alternative

Leptin Protein, Carassius auratus (P.pastoris, His), Others, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/leptin-protein-carassius-auratus-p-pastoris-his.html

Purity

96.00

Smiles

PVHPDRLKNMVKLQADTIILRIKDHNEKLKLYPKLLIGDPELYPEVPADRHIQGLGSIMDTLTIFQKVLQRLPKGHVSQIRSDLSTLLGYLKERTTSMHCILKEPANGRSLDAFLEENATHHITLGYLALDRLKQFMQKLIVNLDQLKSC

Molecular Formula

/ (Gene_ID) B8YI02 (P22-C171) (Accession)

Molecular Weight

Approximately 17.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB9 Polyclonal Antibody, HRP Conjugated
bs-6177R-HRP 100 µL

RAB9 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Human 3 ketoacyl CoA thiolase, mitochondrial (ACAA2) ELISA Kit
MBS7243830-01 48 Well

Human 3 ketoacyl CoA thiolase, mitochondrial (ACAA2) ELISA Kit

Sign In for Pricing
View Details
Human 3 ketoacyl CoA thiolase, mitochondrial (ACAA2) ELISA Kit
MBS7243830-02 96 Well

Human 3 ketoacyl CoA thiolase, mitochondrial (ACAA2) ELISA Kit

Sign In for Pricing
View Details
Human 3 ketoacyl CoA thiolase, mitochondrial (ACAA2) ELISA Kit
MBS7243830-03 5x 96 Well

Human 3 ketoacyl CoA thiolase, mitochondrial (ACAA2) ELISA Kit

Sign In for Pricing
View Details
Human 3 ketoacyl CoA thiolase, mitochondrial (ACAA2) ELISA Kit
MBS7243830-04 10x 96 Well

Human 3 ketoacyl CoA thiolase, mitochondrial (ACAA2) ELISA Kit

Sign In for Pricing
View Details
STS1 Antibody
orb851822 2 mg

STS1 Antibody

Sign In for Pricing
View Details