Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacteria phage T4 Single-stranded DNA-binding protein (32)

Product Specifications

Product Name Alternative

(SSB protein) (Gp32) (Helix-destabilizing protein)

Abbreviation

Recombinant Enterobacteria phage T4 Single-stranded DNA-binding protein

Gene Name

32

UniProt

P03695

Expression Region

1-301aa

Organism

Enterobacteria phage T4 (Bacteriophage T4)

Target Sequence

MFKRKSTAELAAQMAKLNGNKGFSSEDKGEWKLKLDNAGNGQAVIRFLPSKNDEQAPFAILVNHGFKKNGKWYIETCSSTHGDYDSCPVCQYISKNDLYNTDNKEYSLVKRKTSYWANILVVKDPAAPENEGKVFKYRFGKKIWDKINAMIAVDVEMGETPVDVTCPWEGANFVLKVKQVSGFSNYDESKFLNQSAIPNIDDESFQKELFEQMVDLSEMTSKDKFKSFEELNTKFGQVMGTAVMGGAAATAAKKADKVADDLDAFNVDDFNTKTEDDFMSSSSGSSSSADDTDLDDLLNDL

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Single-stranded DNA-binding protein that participates in viral DNA replication, recombination, and repair (Probable) . Coats the lagging-strand ssDNA as the replication fork advances . Stimulates the activities of viral DNA polymerase and DnaB-like SF4 replicative helicase, probably via its interaction with the helicase assembly factor . Together with DnaB-like SF4 replicative helicase and the helicase assembly factor, promotes pairing of two homologous DNA molecules containing complementary single-stranded regions and mediates homologous DNA strand exchange . Promotes also the formation of joint molecules . mRNA specific autogenous translational repressor .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

46.5 kDa

References & Citations

"Dual functions of single-stranded DNA-binding protein in helicase loading at the bacteriophage T4 DNA replication fork." Ma Y., Wang T., Villemain J.L., Giedroc D.P., Morrical S.W. J. Biol. Chem. 279:19035-19045 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MEF2A pThr319 Rabbit Polyclonal Antibody
AP09461PU-S 50 µL

MEF2A pThr319 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Bay 61-3606 Hydrochloride
1796-1 1 mg

Bay 61-3606 Hydrochloride

Sign In for Pricing
View Details
Recombinant Acinetobacter baumannii Indole-3-glycerol phosphate synthase (trpC)
MBS1016556-01 0.02 mg (E-Coli)

Recombinant Acinetobacter baumannii Indole-3-glycerol phosphate synthase (trpC)

Sign In for Pricing
View Details
Recombinant Acinetobacter baumannii Indole-3-glycerol phosphate synthase (trpC)
MBS1016556-02 0.02 mg (Yeast)

Recombinant Acinetobacter baumannii Indole-3-glycerol phosphate synthase (trpC)

Sign In for Pricing
View Details
Recombinant Acinetobacter baumannii Indole-3-glycerol phosphate synthase (trpC)
MBS1016556-03 0.1 mg (E-Coli)

Recombinant Acinetobacter baumannii Indole-3-glycerol phosphate synthase (trpC)

Sign In for Pricing
View Details
Recombinant Acinetobacter baumannii Indole-3-glycerol phosphate synthase (trpC)
MBS1016556-04 0.1 mg (Yeast)

Recombinant Acinetobacter baumannii Indole-3-glycerol phosphate synthase (trpC)

Sign In for Pricing
View Details