Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-17A, Mouse (HEK293, His)

IL-17A is a homodimeric cytokine and plays a critical role in host defense mechanisms against many bacterial and fungal pathogens as well as allergic and autoimmune responses. IL-17A induces the production of antimicrobial peptides, cytokines, chemokines, and matrix metalloproteinases[1][2]. IL-17A Protein, Mouse (HEK293, His) is a recombinant mouse IL-17A protein with His tag at the C-terminus and is expressed in HEK293 cells. It consists of 137 amino acids (T22-A158) .

Product Specifications

Product Name Alternative

IL-17A Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-17a-protein-mouse-hek293-his.html

Purity

98.0

Smiles

TVKAAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA

Molecular Formula

16171 (Gene_ID) Q62386 (T22-A158) (Accession)

Molecular Weight

Approximately 17-26 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Chen K, et al. Interluekin-17A (IL17A) . Gene. 2017 May 30;614:8-14.|[2]Iwakura Y, et al. The roles of IL-17A in inflammatory immune responses and host defense against pathogens. Immunol Rev. 2008 Dec;226:57-79.|[3]Cua DJ, et al. Innate IL-17-producing cells: the sentinels of the immune system. Nat Rev Immunol. 2010 Jul;10 (7) :479-89.|[4]Wright JF, et al. The human IL-17F/IL-17A heterodimeric cytokine signals through the IL-17RA/IL-17RC receptor complex. J Immunol. 2008 Aug 15;181 (4) :2799-805.|[5]Pelidou SH, et al. Enhancement of acute phase and inhibition of chronic phase of experimental autoimmune neuritis in Lewis rats by intranasal administration of recombinant mouse interleukin 17: potential immunoregulatory role. Exp Neurol. 2000 May;163 (1) :165-72.|[6]Liu Y, et al. IL-17A and TNF-α exert synergistic effects on expression of CXCL5 by alveolar type II cells in vivo and in vitro. J Immunol. 2011 Mar 1;186 (5) :3197-205.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CHO Monoclonal Complement Component C5aR1 Antibody (G2 patent anti-C5aR) - Humanized - (Dry Ice)
NBP3-28649-100ug 100 µg

CHO Monoclonal Complement Component C5aR1 Antibody (G2 patent anti-C5aR) - Humanized - (Dry Ice)

Ask
View Details
CASKIN1 (NM_020764) Human Tagged ORF Clone Lentiviral Particle
RC214385L4V 200 µL

CASKIN1 (NM_020764) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
Human HIST1H2BH Protein Lysate
MBS8412962-01 0.02 mg

Human HIST1H2BH Protein Lysate

Ask
View Details
Human HIST1H2BH Protein Lysate
MBS8412962-02 5x 0.02 mg

Human HIST1H2BH Protein Lysate

Ask
View Details
ERK1/2 Antibody
MBS5314885-01 0.1 mL

ERK1/2 Antibody

Ask
View Details
ERK1/2 Antibody
MBS5314885-02 5x 0.1 mL

ERK1/2 Antibody

Ask
View Details