Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-13, Mouse (His)

IL-13 protein is a cytokine involved in allergic inflammation, immune response to parasites, and B cell proliferation. Animal-Free IL-13 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-13 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-13 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-13-protein-mouse-his.html

Purity

95.0

Smiles

MPVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF

Molecular Formula

16163 (Gene_ID) P20109 (P22-F131) (Accession)

Molecular Weight

Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C-Kit Antibody / SCFR / CD117
V5051SAF-100UG 100 µg

C-Kit Antibody / SCFR / CD117

Sign In for Pricing
View Details
Gpx7 ORF Vector (Rat) (pORF)
22627016 1.0 µg DNA

Gpx7 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
OR51A7 Antibody
MBS9606552-01 0.1 mL

OR51A7 Antibody

Sign In for Pricing
View Details
OR51A7 Antibody
MBS9606552-02 0.2 mL

OR51A7 Antibody

Sign In for Pricing
View Details
OR51A7 Antibody
MBS9606552-03 5x 0.2 mL

OR51A7 Antibody

Sign In for Pricing
View Details
ETL Protein (ELTD1) Rabbit anti-Human Polyclonal Antibody
GWB-EA5848 0.05 mg

ETL Protein (ELTD1) Rabbit anti-Human Polyclonal Antibody

Sign In for Pricing
View Details