Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Thymosin beta-10 (TMSB10)

Product Specifications

Abbreviation

Recombinant Human TMSB10 protein

Gene Name

TMSB10

UniProt

P63313

Expression Region

2-44aa

Organism

Homo sapiens (Human)

Target Sequence

ADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEIS

Tag

N-terminal GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

31.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL-11, BioAssayTM ELISA Kit (Human) (Interleukin 11)
352919 96 Tests

IL-11, BioAssayTM ELISA Kit (Human) (Interleukin 11)

Sign In for Pricing
View Details
MPHOSPH9 Peptide
DF4184-BP 1 mg

MPHOSPH9 Peptide

Sign In for Pricing
View Details
Rat Zinc Finger Protein 658B (ZNF658B) ELISA Kit
MBS9921172-01 48 Well

Rat Zinc Finger Protein 658B (ZNF658B) ELISA Kit

Sign In for Pricing
View Details
Rat Zinc Finger Protein 658B (ZNF658B) ELISA Kit
MBS9921172-02 96 Well

Rat Zinc Finger Protein 658B (ZNF658B) ELISA Kit

Sign In for Pricing
View Details
Rat Zinc Finger Protein 658B (ZNF658B) ELISA Kit
MBS9921172-03 5x 96 Well

Rat Zinc Finger Protein 658B (ZNF658B) ELISA Kit

Sign In for Pricing
View Details
Rat Zinc Finger Protein 658B (ZNF658B) ELISA Kit
MBS9921172-04 10x 96 Well

Rat Zinc Finger Protein 658B (ZNF658B) ELISA Kit

Sign In for Pricing
View Details