TGFBR2/TGF-beta RII, Human (HEK293, Fc)
TGF-beta receptor 2 Protein, Human (HEK293, Fc), a fragment of transforming growth factor-beta receptor type 2 (TβRII), consists of amino acid of Thr23-Asp159 with an Fc tag at the C-terminus.
Product Specifications
Product Name Alternative
TGFBR2/TGF-beta RII Protein, Human (HEK293, Fc), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/tgf-beta-receptor-2-protein-human-hek293-fc.html
Purity
96.46
Smiles
TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPD
Molecular Formula
7048 (Gene_ID) P37173-1 (I24-D159) (Accession)
Molecular Weight
Approximately 55-75 kDa
References & Citations
[1]Gao N, et al. Clinical Implications of TβRII Expression in Breast Cancer. PLoS One. 2015 Nov 9;10 (11) :e0141412.|[2]Cárcamo J, et al. Disruption of transforming growth factor beta signaling by a mutation that preventstransphosphorylation within the receptor complex. Mol Cell Biol. 1995 Mar;15 (3) :1573-81.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC042853-500 1x 500 µL
CD54 / ICAM-1 (15.2), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940460-100 1x 100 µL
CD44 Standard (156-3C11), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680977-100 1x 100 µL
TGF-beta (1D11.16.8), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400218-100 1x 100 µL
CD100 (Semaphorin-4D) (A8), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401422-500 1x 500 µL
NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (NX2/1422R), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details