Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIP-1 alpha/CCL3, Human (CHO)

MIP-1 alpha/CCL3 Protein, Human (CHO), an important chemokine, is a key regulator of immune microenvironment and primarily mediates the trafficking of immune cells in both inflammation and cancer. MIP-1 alpha/CCL3 Protein, Human (CHO) is a recombinant human CCL3 (A27-A92) expressed by CHO[1].

Product Specifications

Product Name Alternative

MIP-1 alpha/CCL3 Protein, Human (CHO), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mip-1-alpha-ccl3-protein-human-cho.html

Purity

95.0

Smiles

ADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA

Molecular Formula

6348 (Gene_ID) P10147 (A27-A92) (Accession)

Molecular Weight

8-10 kDa

References & Citations

[1]Zhang G, et al. CCL3 participates in the development of rheumatoid arthritis by activating AKT. Eur Rev Med Pharmacol Sci. 2018 Oct;22 (20) :6625-6632.|[2]Zhang G, et al. CCL3 participates in the development of rheumatoid arthritis by activating AKT. Eur Rev Med Pharmacol Sci. 2018 Oct;22 (20) :6625-6632.|[3]Fabrizio Montecucco, et al. Tumor necrosis factor-alpha (TNF-alpha) induces integrin CD11b/CD18 (Mac-1) up-regulation and migration to the CC chemokine CCL3 (MIP-1alpha) on human neutrophils through defined signalling pathways. Cell Signal. 2008 Mar;20 (3) :557-68.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FANCG (609-622) Goat Polyclonal Antibody
AP22490PU-N 50 µg

FANCG (609-622) Goat Polyclonal Antibody

Sign In for Pricing
View Details
MelanA (MLANA) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1F12]
TA506048AM 100 µL

MelanA (MLANA) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1F12]

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF555 conjugate, 0.1mg/mL
BNC550525-500 1x 500 µL

CD63 (MX-49.129.5), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Rat VWF protein (His tag)
PDER100170-01 20 µg

Recombinant Rat VWF protein (His tag)

Sign In for Pricing
View Details
Recombinant Rat VWF protein (His tag)
PDER100170-02 100 µg

Recombinant Rat VWF protein (His tag)

Sign In for Pricing
View Details
Recombinant Rat VWF protein (His tag)
PDER100170-03 500 µg

Recombinant Rat VWF protein (His tag)

Sign In for Pricing
View Details