Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAPKSP1, Human (His)

The MAPKSP1 protein, also known as porphobilinogen deaminase (HMBS), is crucial in the heme biosynthetic pathway and catalyzes the sequential polymerization of four porphobilinogen molecules to form hydroxymethyl bixane. The process begins with the assembly of the dipyrromethane cofactor of porphobilinogen or preuroporphyrinogen. MAPKSP1 Protein, Human (His) is the recombinant human-derived MAPKSP1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

MAPKSP1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mapksp1-protein-human-his.html

Purity

95.00

Smiles

MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELRQVVEVS

Molecular Formula

8649 (Gene_ID) Q9UHA4 (M1-S124) (Accession)

Molecular Weight

Approximately 15.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DAO Sheep Polyclonal Antibody
TA397078S 25 µL

DAO Sheep Polyclonal Antibody

Sign In for Pricing
View Details
TopBP1 Recombinant Rabbit monoclonal Antibody
HA750690 100 µL

TopBP1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (rIG266), CF640R conjugate, 0.1mg/mL
BNC401789-500 1x 500 µL

Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (rIG266), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FAK (PTK2) (NM_153831) Human Over-expression Lysate
LY403521 100 µg

FAK (PTK2) (NM_153831) Human Over-expression Lysate

Sign In for Pricing
View Details
EBNA1 binding protein 2 (EBNA1BP2) Rabbit Polyclonal Antibody
TA375694 100 µL

EBNA1 binding protein 2 (EBNA1BP2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Diofenolan
TRC-D505085-10MG 10 mg

Diofenolan

Sign In for Pricing
View Details