Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAPKSP1, Human (His)

The MAPKSP1 protein, also known as porphobilinogen deaminase (HMBS), is crucial in the heme biosynthetic pathway and catalyzes the sequential polymerization of four porphobilinogen molecules to form hydroxymethyl bixane. The process begins with the assembly of the dipyrromethane cofactor of porphobilinogen or preuroporphyrinogen. MAPKSP1 Protein, Human (His) is the recombinant human-derived MAPKSP1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

MAPKSP1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mapksp1-protein-human-his.html

Purity

95.00

Smiles

MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELRQVVEVS

Molecular Formula

8649 (Gene_ID) Q9UHA4 (M1-S124) (Accession)

Molecular Weight

Approximately 15.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BCL2L15 (NM_001010922) Human Recombinant Protein
TP323374 20 µg

BCL2L15 (NM_001010922) Human Recombinant Protein

Sign In for Pricing
View Details
PICK1 (NM_001039583) Human Over-expression Lysate
LC422082 20 µg

PICK1 (NM_001039583) Human Over-expression Lysate

Sign In for Pricing
View Details
Sun1 Mouse Gene Knockout Kit (CRISPR)
KN516983 1 Kit

Sun1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Benzoyl Chloride
TRC-B209550-500ML 500 mL

Benzoyl Chloride

Sign In for Pricing
View Details
Delta-Valerolactam-d4
TRC-V091441-5MG 5 mg

Delta-Valerolactam-d4

Sign In for Pricing
View Details
(1R,3R,4R)-(-)-3,5-Dinitrobenzoate Menthol
TRC-D480025-50MG 50 mg

(1R,3R,4R)-(-)-3,5-Dinitrobenzoate Menthol

Sign In for Pricing
View Details