Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAPKSP1, Human (His)

The MAPKSP1 protein, also known as porphobilinogen deaminase (HMBS), is crucial in the heme biosynthetic pathway and catalyzes the sequential polymerization of four porphobilinogen molecules to form hydroxymethyl bixane. The process begins with the assembly of the dipyrromethane cofactor of porphobilinogen or preuroporphyrinogen. MAPKSP1 Protein, Human (His) is the recombinant human-derived MAPKSP1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

MAPKSP1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mapksp1-protein-human-his.html

Purity

95.00

Smiles

MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELRQVVEVS

Molecular Formula

8649 (Gene_ID) Q9UHA4 (M1-S124) (Accession)

Molecular Weight

Approximately 15.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E3 ubiquitin ligase Polyclonal Antibody, Cy5.5 Conjugated
bs-9663R-Cy5.5 100 µL

E3 ubiquitin ligase Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
DBX2 antibody - N-terminal region (ARP47495_P050)
ARP47495_P050 100 µL

DBX2 antibody - N-terminal region (ARP47495_P050)

Sign In for Pricing
View Details
(4,5-Dihydro-thiazol-2-yl) -hexyl-amine
sc-349795 1 g

(4,5-Dihydro-thiazol-2-yl) -hexyl-amine

Sign In for Pricing
View Details
Recombinant Human LIPC Protein, N-His
YHC85701 100 μg

Recombinant Human LIPC Protein, N-His

Sign In for Pricing
View Details
ZNF835 shRNA Plasmid (h)
sc-97123-SH 20 µg

ZNF835 shRNA Plasmid (h)

Sign In for Pricing
View Details
HMGB4 3'UTR Luciferase Stable Cell Line
TU009977 1.0 mL

HMGB4 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details