Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAFA2/FAM19A2, Human

The FAM19A2 protein plays a key role as a neurotrophic factor, actively promoting neuronal survival and various neurobiological functions. Its involvement is shown to have a critical impact on the maintenance and health of neurons, underscoring its potential significance in supporting neurological health. TAFA2/FAM19A2 Protein, Human is the recombinant human-derived TAFA2/FAM19A2 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

TAFA2/FAM19A2 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tafa2-fam19a2-protein-human.html

Purity

95.77

Smiles

ANHHKAHHVKTGTCEVVALHRCCNKNKIEERSQTVKCSCFPGQVAGTTRAAPSCVDASIVEQKWWCHMQPCLEGEECKVLPDRKGWSCSSGNKVKTTRVTH

Molecular Formula

338811 (Gene_ID) Q8N3H0-1 (A31-H131) (Accession)

Molecular Weight

11-15 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kinesis Ferrule Sealtight PEEK 1/16
CHR3385-01 1 Each

Kinesis Ferrule Sealtight PEEK 1/16

Sign In for Pricing
View Details
Kinesis Ferrule Sealtight PEEK 1/16
CHR3385-02 10 / PCK

Kinesis Ferrule Sealtight PEEK 1/16

Sign In for Pricing
View Details
CDw75 (ST6GAL1) (NM_003032) Human Tagged ORF Clone Lentiviral Particle
RC208061L4V 200 µL

CDw75 (ST6GAL1) (NM_003032) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mouse Factor XII Genetically Deficient Kidney Tissue Lysate 100ug
IMSFXIIGDKDTL100UG 100 µg

Mouse Factor XII Genetically Deficient Kidney Tissue Lysate 100ug

Sign In for Pricing
View Details
PP2A alpha + beta Polyclonal Antibody, PE-Cy5 Conjugated
bs-6706R-PE-Cy5 100 µL

PP2A alpha + beta Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
4- (4,4,5,5-Tetraethyl-1,3,2-dioxaborolan-2-yl) pyridine
OR77366-01 250 mg

4- (4,4,5,5-Tetraethyl-1,3,2-dioxaborolan-2-yl) pyridine

Sign In for Pricing
View Details