Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NINJ1, Mouse (Cell-Free, His)

The NINJ1 protein is an important mediator of programmed cell death, inducing plasma membrane rupture in necroptosis and pyroptosis. NINJ1 is activated by Gasdermin or MLKL, oligomerizes, releases DAMPs and exacerbates inflammation. NINJ1 Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived NINJ1 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

Product Specifications

Product Name Alternative

NINJ1 Protein, Mouse (Cell-Free, His), Mouse, E. coli Cell-free

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ninj1-protein-mouse-cf-his.html

Purity

91.20

Smiles

MESGTEEYELNGDLRPGSPGSPDALPPRWGLRNRPINVNHYANKKSAAESMLDIALLMANASQLKAVVEQGNDFAFFVPLVVLISISLVLQIGVGVLLIFLVKYDLNNPAKHAKLDFLNNLATGLVFIIVVVNIFITAFGVQKPVMDVAPRQ

Molecular Formula

18081 (Gene_ID) O70131 (M1-Q152) (Accession)

Molecular Weight

19 kDa&35 kDa&57 kDa&76 kDa&114 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ceftizoxime
TRC-C244760-50MG 50 mg

Ceftizoxime

Sign In for Pricing
View Details
CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/3247), CF740 conjugate, 0.1mg/mL
BNC743247-500 1x 500 µL

CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/3247), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Prss34 Mouse Gene Knockout Kit (CRISPR)
KN514035 1 Kit

Prss34 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
OR5AR1 (NM_001004730) Human Over-expression Lysate
LY423913 100 µg

OR5AR1 (NM_001004730) Human Over-expression Lysate

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF647 conjugate, 0.1mg/mL
BNC470633-500 1x 500 µL

Von Willebrand Factor (3E2D10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
1-Bromo-3-chlorobenzene
TRC-B682215-25G 25 g

1-Bromo-3-chlorobenzene

Sign In for Pricing
View Details