Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NINJ1, Mouse (Cell-Free, His)

The NINJ1 protein is an important mediator of programmed cell death, inducing plasma membrane rupture in necroptosis and pyroptosis. NINJ1 is activated by Gasdermin or MLKL, oligomerizes, releases DAMPs and exacerbates inflammation. NINJ1 Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived NINJ1 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

Product Specifications

Product Name Alternative

NINJ1 Protein, Mouse (Cell-Free, His), Mouse, E. coli Cell-free

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ninj1-protein-mouse-cf-his.html

Purity

91.20

Smiles

MESGTEEYELNGDLRPGSPGSPDALPPRWGLRNRPINVNHYANKKSAAESMLDIALLMANASQLKAVVEQGNDFAFFVPLVVLISISLVLQIGVGVLLIFLVKYDLNNPAKHAKLDFLNNLATGLVFIIVVVNIFITAFGVQKPVMDVAPRQ

Molecular Formula

18081 (Gene_ID) O70131 (M1-Q152) (Accession)

Molecular Weight

19 kDa&35 kDa&57 kDa&76 kDa&114 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement C1q Tumor Necrosis Factor Related protein 1 (C1QTNF1/CTRP1) Human ELISA Kit
C5435 96 Tests

Complement C1q Tumor Necrosis Factor Related protein 1 (C1QTNF1/CTRP1) Human ELISA Kit

Sign In for Pricing
View Details
Recombinant Xenopus laevis Ribonuclease kappa-B (rnasek-b), partial
MBS7082870 Inquire

Recombinant Xenopus laevis Ribonuclease kappa-B (rnasek-b), partial

Sign In for Pricing
View Details
IRAK2 Antibody
CSB-PA003062-01 50 µg

IRAK2 Antibody

Sign In for Pricing
View Details
IRAK2 Antibody
CSB-PA003062-02 100 µg

IRAK2 Antibody

Sign In for Pricing
View Details
ARHGAP22 antibody
70R-51061 100 ul

ARHGAP22 antibody

Sign In for Pricing
View Details
TRAP220 Polyclonal Antibody, PerCP Conjugated
bs-4223R-PerCP 100 µL

TRAP220 Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details