Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Outer membrane X/OmpX, E.coli (Myc, His)

Outer membrane protein X/OmpX protein is an important member of the outer membrane OOP (TC 1.B.6) superfamily, specifically belonging to the OmpX family. It plays a vital role in cellular processes and shares common structural and functional features among the OmpX family. Outer membrane protein X/OmpX Protein, E.coli (Myc, His) is the recombinant E. coli-derived Outer membrane protein X/OmpX protein, expressed by E. coli , with N-His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Outer membrane protein X/OmpX Protein, E.coli (Myc, His), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/outer-membrane-protein-x-ompx-protein-e-coli-myc-his.html

Purity

95.00

Smiles

ATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTASSGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKHDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF

Molecular Formula

917632 (Gene_ID) P0A919 (A24-F171) (Accession)

Molecular Weight

Approximately 27 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti Human PYGO2 Monoclonal Clone ABI-16 100UL
IRBAHUPYGO2ABI16C100UL 100 µL

Rabbit Anti Human PYGO2 Monoclonal Clone ABI-16 100UL

Sign In for Pricing
View Details
FCGR1A Antibody
MBS9606988-01 0.1 mL

FCGR1A Antibody

Sign In for Pricing
View Details
FCGR1A Antibody
MBS9606988-02 0.2 mL

FCGR1A Antibody

Sign In for Pricing
View Details
FCGR1A Antibody
MBS9606988-03 5x 0.2 mL

FCGR1A Antibody

Sign In for Pricing
View Details
Papilloma Virus, Human, Type 16, E7 Protein (HPV) (MaxLight 405)
MBS6253121-01 0.1 mL

Papilloma Virus, Human, Type 16, E7 Protein (HPV) (MaxLight 405)

Sign In for Pricing
View Details
Papilloma Virus, Human, Type 16, E7 Protein (HPV) (MaxLight 405)
MBS6253121-02 5x 0.1 mL

Papilloma Virus, Human, Type 16, E7 Protein (HPV) (MaxLight 405)

Sign In for Pricing
View Details