HAI-2, Mouse (HEK293, His)
HAI-2 Protein functions as an inhibitor for various proteases, including HGFAC, plasmin, and plasma kallikrein.It also inhibits TMPRSS13 and ST14/matriptase, regulating their serine protease activity.The interaction with TMPRSS13 promotes its phosphorylation and cell membrane localization.HAI-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived HAI-2 protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
HAI-2 Protein, Mouse (HEK293, His), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/hai-2-protein-mouse-hek293-his.html
Purity
96.00
Smiles
ASRELDVHENTTDDMARNRNGADSSVLSVPRKQSAEDLSAEIFNYEEYCVPKAVTGPCRAAFPRWYYDTEKNSCISFIYGGCRGNKNSYLSQEACMQHCSGKQMHPFLTPGLK
Molecular Formula
20733 (Gene_ID) Q9WU03-2 /NP_001076017.1 (A28-K140) (Accession)
Molecular Weight
Approximately 19-22 kDa due to the glycosylation
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
CSF1R (CSF1R, FMS, Macrophage colony-stimulating factor 1 receptor, CSF-1 receptor, Proto-oncogene c-Fms, CD115) (Azide free) (HRP) discontinued
Monkey Mediator Of RNA Polymerase II Transcription Subunit 7 (MED7) ELISA Kit
Monkey Mediator Of RNA Polymerase II Transcription Subunit 7 (MED7) ELISA Kit
Monkey Mediator Of RNA Polymerase II Transcription Subunit 7 (MED7) ELISA Kit
Monkey Mediator Of RNA Polymerase II Transcription Subunit 7 (MED7) ELISA Kit