Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HAI-2, Mouse (HEK293, His)

HAI-2 Protein functions as an inhibitor for various proteases, including HGFAC, plasmin, and plasma kallikrein.It also inhibits TMPRSS13 and ST14/matriptase, regulating their serine protease activity.The interaction with TMPRSS13 promotes its phosphorylation and cell membrane localization.HAI-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived HAI-2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

HAI-2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hai-2-protein-mouse-hek293-his.html

Purity

96.00

Smiles

ASRELDVHENTTDDMARNRNGADSSVLSVPRKQSAEDLSAEIFNYEEYCVPKAVTGPCRAAFPRWYYDTEKNSCISFIYGGCRGNKNSYLSQEACMQHCSGKQMHPFLTPGLK

Molecular Formula

20733 (Gene_ID) Q9WU03-2 /NP_001076017.1 (A28-K140) (Accession)

Molecular Weight

Approximately 19-22 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal NASP Antibody [Alexa Fluor 750]
NBP3-06445AF750 0.1 mL

Rabbit Polyclonal NASP Antibody [Alexa Fluor 750]

Ask
View Details
Human NLRP8 activation kit by CRISPRa
GA114922 1 Kit

Human NLRP8 activation kit by CRISPRa

Ask
View Details
Mouse Hnrnpd ELISA KIT
ELI-20339m 96 Tests

Mouse Hnrnpd ELISA KIT

Ask
View Details
Lentiviral human TXNDC5 sgRNA gene knockout kit - Lentiviral human TXNDC5 sgRNA gene knockout kit (25)
GTR15360780 1 Vial

Lentiviral human TXNDC5 sgRNA gene knockout kit - Lentiviral human TXNDC5 sgRNA gene knockout kit (25)

Ask
View Details
RGD1308385 AAV Vector (Rat) (CMV)
39034106 1 µg

RGD1308385 AAV Vector (Rat) (CMV)

Ask
View Details
SENP6, NT (SUSP1, Sentrin-specific Protease 6, Sentrin/SUMO-specific Protease SENP6, SUMO-1-specific Protease 1, KIAA0797, SSP1, FKSG6) (Azide free) (HRP) discontinued
S0745-05D-HRP 200 µL

SENP6, NT (SUSP1, Sentrin-specific Protease 6, Sentrin/SUMO-specific Protease SENP6, SUMO-1-specific Protease 1, KIAA0797, SSP1, FKSG6) (Azide free) (HRP) discontinued

Ask
View Details