Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HAI-2, Mouse (HEK293, His)

HAI-2 Protein functions as an inhibitor for various proteases, including HGFAC, plasmin, and plasma kallikrein.It also inhibits TMPRSS13 and ST14/matriptase, regulating their serine protease activity.The interaction with TMPRSS13 promotes its phosphorylation and cell membrane localization.HAI-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived HAI-2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

HAI-2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hai-2-protein-mouse-hek293-his.html

Purity

96.00

Smiles

ASRELDVHENTTDDMARNRNGADSSVLSVPRKQSAEDLSAEIFNYEEYCVPKAVTGPCRAAFPRWYYDTEKNSCISFIYGGCRGNKNSYLSQEACMQHCSGKQMHPFLTPGLK

Molecular Formula

20733 (Gene_ID) Q9WU03-2 /NP_001076017.1 (A28-K140) (Accession)

Molecular Weight

Approximately 19-22 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

P2RY9 Antibody
ABD10261 100 µg

P2RY9 Antibody

Ask
View Details
Gel Extraction Kit
N1071 50 Reactions

Gel Extraction Kit

Ask
View Details
Steroidogenic Factor 1 (SF1, SF-1, STF-1, Adrenal 4-binding Protein, AD4BP, ELP, Fushi Tarazu Factor Homolog 1, FTZ1, FTZF1, Nuclear Receptor Subfamily 5 Group A Member 1, NR5A1, POF7, Steroid Hormone Receptor Ad4BP) (Biotin) discontinued
138394-Biotin 100 µL

Steroidogenic Factor 1 (SF1, SF-1, STF-1, Adrenal 4-binding Protein, AD4BP, ELP, Fushi Tarazu Factor Homolog 1, FTZ1, FTZF1, Nuclear Receptor Subfamily 5 Group A Member 1, NR5A1, POF7, Steroid Hormone Receptor Ad4BP) (Biotin) discontinued

Ask
View Details
Estrogen sulfotransferase (SULT1E1) Guinea Pig ELISA Kit
D2594 96 Tests

Estrogen sulfotransferase (SULT1E1) Guinea Pig ELISA Kit

Ask
View Details
IL17F Rabbit Polyclonal Antibody
TA355450 100 µL

IL17F Rabbit Polyclonal Antibody

Ask
View Details
Tpgs2 Mouse qPCR Primer Pair (NM_001004361)
MP214093 200 Reactions

Tpgs2 Mouse qPCR Primer Pair (NM_001004361)

Ask
View Details