HAI-2, Mouse (HEK293, His)
HAI-2 Protein functions as an inhibitor for various proteases, including HGFAC, plasmin, and plasma kallikrein.It also inhibits TMPRSS13 and ST14/matriptase, regulating their serine protease activity.The interaction with TMPRSS13 promotes its phosphorylation and cell membrane localization.HAI-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived HAI-2 protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
HAI-2 Protein, Mouse (HEK293, His), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/hai-2-protein-mouse-hek293-his.html
Purity
96.00
Smiles
ASRELDVHENTTDDMARNRNGADSSVLSVPRKQSAEDLSAEIFNYEEYCVPKAVTGPCRAAFPRWYYDTEKNSCISFIYGGCRGNKNSYLSQEACMQHCSGKQMHPFLTPGLK
Molecular Formula
20733 (Gene_ID) Q9WU03-2 /NP_001076017.1 (A28-K140) (Accession)
Molecular Weight
Approximately 19-22 kDa due to the glycosylation
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
![Rat Monoclonal IL-27/IL-35 EBI3 Subunit Antibody (5P6G8) [DyLight 488]](https://cdn.genprice.uk/genprice/uk/genprice4.webp)
Rat Monoclonal IL-27/IL-35 EBI3 Subunit Antibody (5P6G8) [DyLight 488]
MITF, NT (MITF, BHLHE32, Microphthalmia-associated transcription factor, Class E basic helix-loop-helix protein 32) (Azide free) (HRP)
MITF, NT (MITF, BHLHE32, Microphthalmia-associated transcription factor, Class E basic helix-loop-helix protein 32) (Azide free) (HRP)
IRF2BP1, aa461-474 (Interferon Regulatory Factor 2 Binding Protein 1, DKFZp434M154)
