Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Beta-NGF, Human (CHO)

Nerve Growth Factor-β (Beta-NGF; NGF) is a neurotrophic factor that regulates neuronal survival and differentiation. NGF is also a seminal plasma protein involved in ovulation and luteinizing. NGF has potential functions in the female reproductive system to help overcome the current problem of early embryo loss[1][2][3]. Beta-NGF Protein, Human (CHO) is produced by CHO cells (S122-R239), with tag free.

Product Specifications

Product Name Alternative

Beta-NGF Protein, Human (CHO), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/beta-ngf-protein-human-cho.html

Purity

96.00

Smiles

SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVR

Molecular Formula

4803 (Gene_ID) P01138 (S122-R239) (Accession)

Molecular Weight

Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Castellanos MR, et al. Obtención y caracterización del beta-NGF murino. Aplicación en un modelo de envejecimiento cerebral [Obtention and characterization of murine beta-NGF. Application in a model of cerebral aging]. Rev Neurol. 1998;26 (153) :717-722.|[2]Lipov EG, et al. Possible Reversal of PTSD-Related DNA Methylation by Sympathetic Blockade. J Mol Neurosci. 2017 May;62 (1) :67-72.|[3]Lima FS, et al. Insights into nerve growth factor-β role in bovine reproduction - Review. Theriogenology. 2020 Jul 1;150:288-293.|[4]Otten U, et al. Nerve growth factor induces growth and differentiation of human B lymphocytes. Proc Natl Acad Sci U S A. 1989 Dec;86 (24) :10059-63.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gper1 Mouse Gene Knockout Kit (CRISPR)
KN307164RB 1 Kit

Gper1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Glypican-3 (GPC3/863 + 1G12), CF594 conjugate, 0.1mg/mL
BNC940864-500 1x 500 µL

Glypican-3 (GPC3/863 + 1G12), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP90 Beta Recombinant Mouse monoclonal Antibody
HA610060 100 µg

HSP90 Beta Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details
LEF1 Sheep Polyclonal Antibody
AP05069PU-N 100 µg

LEF1 Sheep Polyclonal Antibody

Sign In for Pricing
View Details
BAG3 Antibody
KC-3027-01 50 μL

BAG3 Antibody

Sign In for Pricing
View Details
BAG3 Antibody
KC-3027-02 100 µL

BAG3 Antibody

Sign In for Pricing
View Details