Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Beta-NGF, Human (CHO)

Nerve Growth Factor-β (Beta-NGF; NGF) is a neurotrophic factor that regulates neuronal survival and differentiation. NGF is also a seminal plasma protein involved in ovulation and luteinizing. NGF has potential functions in the female reproductive system to help overcome the current problem of early embryo loss[1][2][3]. Beta-NGF Protein, Human (CHO) is produced by CHO cells (S122-R239), with tag free.

Product Specifications

Product Name Alternative

Beta-NGF Protein, Human (CHO), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/beta-ngf-protein-human-cho.html

Purity

96.00

Smiles

SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVR

Molecular Formula

4803 (Gene_ID) P01138 (S122-R239) (Accession)

Molecular Weight

Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Castellanos MR, et al. Obtención y caracterización del beta-NGF murino. Aplicación en un modelo de envejecimiento cerebral [Obtention and characterization of murine beta-NGF. Application in a model of cerebral aging]. Rev Neurol. 1998;26 (153) :717-722.|[2]Lipov EG, et al. Possible Reversal of PTSD-Related DNA Methylation by Sympathetic Blockade. J Mol Neurosci. 2017 May;62 (1) :67-72.|[3]Lima FS, et al. Insights into nerve growth factor-β role in bovine reproduction - Review. Theriogenology. 2020 Jul 1;150:288-293.|[4]Otten U, et al. Nerve growth factor induces growth and differentiation of human B lymphocytes. Proc Natl Acad Sci U S A. 1989 Dec;86 (24) :10059-63.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eloc Mouse Gene Knockout Kit (CRISPR)
KN517313 1 Kit

Eloc Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IL-1β (Cleaved-Asp210) Antibody
8L0114-AAT 50 µg

IL-1β (Cleaved-Asp210) Antibody

Sign In for Pricing
View Details
3-Dehydro Retinal
TRC-D230075-25MG 25 mg

3-Dehydro Retinal

Sign In for Pricing
View Details
Human PARK7 Recombinant Mouse monoclonal Antibody
HA620002 100 µL

Human PARK7 Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details
(1’S,2R)-2-[(1’,2’-O-Isopropylidene)dihydroxyethyl]-6-fluorochroman-4-one
TRC-I824945-250MG 250 mg

(1’S,2R)-2-[(1’,2’-O-Isopropylidene)dihydroxyethyl]-6-fluorochroman-4-one

Sign In for Pricing
View Details
CIP2A Recombinant Rabbit monoclonal Antibody
HA751590 100 µL

CIP2A Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details