Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free EGF, Pig (His)

The EGF protein acts as a potent stimulator of growth in a variety of epidermal and epithelial tissues in both in vivo and in vitro settings and exhibits growth-promoting effects on certain fibroblasts in cell culture. Animal-Free EGF Protein, Pig (His) is the recombinant pig-derived animal-FreeEGF protein, expressed by E. coli , with C-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free EGF Protein, Pig (His), Pig, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-egf-protein-pig-his.html

Purity

95.0

Smiles

MNSYSECPPSHDGYCLHGGVCMYIEAVDSYACNCVFGYVGERCQHRDLKWWELR

Molecular Formula

397083 (Gene_ID) Q00968 (N970-R1022) (Accession)

Molecular Weight

Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human U2AF2 Pre-designed siRNA Set A
SI017669A 1 Each

Human U2AF2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Anti-PD-1 Antibody-HRP (4V697)
TMAY-03116H 100 µg

Anti-PD-1 Antibody-HRP (4V697)

Sign In for Pricing
View Details
CD98 Protein, Mouse, Recombinant (His Tag)
E45M53462M1-50 50 µg

CD98 Protein, Mouse, Recombinant (His Tag)

Sign In for Pricing
View Details
Anti-CDX2 Antibody (R3W03)
RHJ45305 100 μg

Anti-CDX2 Antibody (R3W03)

Sign In for Pricing
View Details
Rat Dual Serine/Threonine And Tyrosine Protein Kinase (DSTYK) ELISA Kit
MBS2000069-01 24 Strip Well

Rat Dual Serine/Threonine And Tyrosine Protein Kinase (DSTYK) ELISA Kit

Sign In for Pricing
View Details
Rat Dual Serine/Threonine And Tyrosine Protein Kinase (DSTYK) ELISA Kit
MBS2000069-02 48 Well

Rat Dual Serine/Threonine And Tyrosine Protein Kinase (DSTYK) ELISA Kit

Sign In for Pricing
View Details