Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kallikrein-5, Human (HEK293, His, solution)

The Kallikrein-5 protein may be involved in desquamation, suggesting a role in the process of skin shedding and exfoliation.Its association with desquamation suggests that it plays a role in regulating the removal of dead skin cells, which is critical for skin homeostasis.Kallikrein-5 Protein, Human (HEK293, His, solution) is the recombinant human-derived Kallikrein-5 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Kallikrein-5 Protein, Human (HEK293, His, solution), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/kallikrein-5-protein-human-hek-293-his.html

Purity

98.0

Smiles

VTEHVLANNDVSCDHPSNTVPSGSNQDLGAGAGEDARSDDSSSRIINGSDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKVFRVRLGHYSLSPVYESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSSHCPSAGTKCLVSGWGTTKSPQVHFPKVLQCLNISVLSQKRCEDAYPRQIDDTMFCAGDKAGRDSCQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCKFTKWIQETIQANS

Molecular Formula

25818 (Gene_ID) Q9Y337 (V23-S293) (Accession)

Molecular Weight

Approximately 35-44 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acid Orange 7 (Technical Grade)
TRC-A305338-250MG 250 mg

Acid Orange 7 (Technical Grade)

Sign In for Pricing
View Details
HDC CRISPR Knock Out 293T Cell Line (Human)
23138141 1x 10^6 Cells / 1.0 mL

HDC CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
RN5S272 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV744415 1.0 µg DNA

RN5S272 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Osbpl6 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4058702 1.0 µg DNA

Osbpl6 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
PD-L1 Antibody
orb1312740 100 µL

PD-L1 Antibody

Sign In for Pricing
View Details
PYCR2 antibody
10R-5541 100 ul

PYCR2 antibody

Sign In for Pricing
View Details