Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VIP, Human (HEK293, His)

VIP is a neuropeptide that induces vasodilation, lowers arterial blood pressure, stimulates myocardial contractility, enhances glycogenolysis, and relaxes tracheal, gastric, and gallbladder smooth muscles. PHM and PHV-related peptides also have vasodilatory properties. VIP Protein, Human (HEK293, His) is the recombinant human-derived VIP protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

VIP Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vip-protein-human-hek-293-his.html

Purity

98.0

Smiles

SQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNG

Molecular Formula

7432 (Gene_ID) P01282-2 (S21-G152) (Accession)

Molecular Weight

Approximately 17-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD61 (AB1290) Rabbit mAb (Ready to Use)
M3737R-01 3 mL

CD61 (AB1290) Rabbit mAb (Ready to Use)

Sign In for Pricing
View Details
CD61 (AB1290) Rabbit mAb (Ready to Use)
M3737R-02 6 mL

CD61 (AB1290) Rabbit mAb (Ready to Use)

Sign In for Pricing
View Details
CD61 (AB1290) Rabbit mAb (Ready to Use)
M3737R-03 10 mL

CD61 (AB1290) Rabbit mAb (Ready to Use)

Sign In for Pricing
View Details
CCDC68 (NM_025214) Human Recombinant Protein
TP306244M 100 µg

CCDC68 (NM_025214) Human Recombinant Protein

Sign In for Pricing
View Details
Histone H3.1 (HIST1H3J, Histone H3R26me2a, H3/j, H3FJ, Histone H3/a, Histone H3/b,Histone H3/c, Histone H3/d, Histone H3/f,Histone H3/h, Histone H3/I,Histone H3/j, _+E_Histone H3/k, Histone H3/l) (MaxLight 405)
MBS6420726-01 0.1 mL

Histone H3.1 (HIST1H3J, Histone H3R26me2a, H3/j, H3FJ, Histone H3/a, Histone H3/b,Histone H3/c, Histone H3/d, Histone H3/f,Histone H3/h, Histone H3/I,Histone H3/j, _+E_Histone H3/k, Histone H3/l) (MaxLight 405)

Sign In for Pricing
View Details
Histone H3.1 (HIST1H3J, Histone H3R26me2a, H3/j, H3FJ, Histone H3/a, Histone H3/b,Histone H3/c, Histone H3/d, Histone H3/f,Histone H3/h, Histone H3/I,Histone H3/j, _+E_Histone H3/k, Histone H3/l) (MaxLight 405)
MBS6420726-02 5x 0.1 mL

Histone H3.1 (HIST1H3J, Histone H3R26me2a, H3/j, H3FJ, Histone H3/a, Histone H3/b,Histone H3/c, Histone H3/d, Histone H3/f,Histone H3/h, Histone H3/I,Histone H3/j, _+E_Histone H3/k, Histone H3/l) (MaxLight 405)

Sign In for Pricing
View Details