Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VIP, Human (HEK293, His)

VIP is a neuropeptide that induces vasodilation, lowers arterial blood pressure, stimulates myocardial contractility, enhances glycogenolysis, and relaxes tracheal, gastric, and gallbladder smooth muscles. PHM and PHV-related peptides also have vasodilatory properties. VIP Protein, Human (HEK293, His) is the recombinant human-derived VIP protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

VIP Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vip-protein-human-hek-293-his.html

Purity

98.0

Smiles

SQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNG

Molecular Formula

7432 (Gene_ID) P01282-2 (S21-G152) (Accession)

Molecular Weight

Approximately 17-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Smek1 (PPP4R3A) (NM_032560) Human Tagged ORF Clone Lentiviral Particle
RC221040L4V 200 µL

Smek1 (PPP4R3A) (NM_032560) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Hsa-miR-1227-3p antagomir
HY-RI00119A-01 5 nmol

Hsa-miR-1227-3p antagomir

Sign In for Pricing
View Details
Hsa-miR-1227-3p antagomir
HY-RI00119A-02 20 nmol

Hsa-miR-1227-3p antagomir

Sign In for Pricing
View Details
Klrb1 ORF Vector (Rat) (pORF)
ORF069151 1.0 µg DNA

Klrb1 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
TSSK6 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
48652124 3x 1.0µg DNA

TSSK6 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Anti-CALCOCO2 Antibody
MBS8245795-01 0.03 mL

Anti-CALCOCO2 Antibody

Sign In for Pricing
View Details