Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VIP, Human (HEK293, His)

VIP is a neuropeptide that induces vasodilation, lowers arterial blood pressure, stimulates myocardial contractility, enhances glycogenolysis, and relaxes tracheal, gastric, and gallbladder smooth muscles. PHM and PHV-related peptides also have vasodilatory properties. VIP Protein, Human (HEK293, His) is the recombinant human-derived VIP protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

VIP Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vip-protein-human-hek-293-his.html

Purity

98.0

Smiles

SQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNG

Molecular Formula

7432 (Gene_ID) P01282-2 (S21-G152) (Accession)

Molecular Weight

Approximately 17-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC35G1 Human shRNA Plasmid Kit (Locus ID 159371)
TR307675 1 Kit

SLC35G1 Human shRNA Plasmid Kit (Locus ID 159371)

Sign In for Pricing
View Details
ZNF493 Protein Vector (Human) (pPM-C-HA)
51560021 500 ng

ZNF493 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
SLC25A13 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2177406 1.0 µg DNA

SLC25A13 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Cytokeratin 5 Recombinant Antibody, APC-Cy7 Conjugated
bsm-52063R-APC-Cy7 100 µL

Cytokeratin 5 Recombinant Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
BC000271 Recombinant Protein (Human)
RP002686 100 µg

BC000271 Recombinant Protein (Human)

Sign In for Pricing
View Details
Acsm2 (NM_146197) Mouse Recombinant Protein
TP509031 20 µg

Acsm2 (NM_146197) Mouse Recombinant Protein

Sign In for Pricing
View Details