Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VIP, Human (HEK293, His)

VIP is a neuropeptide that induces vasodilation, lowers arterial blood pressure, stimulates myocardial contractility, enhances glycogenolysis, and relaxes tracheal, gastric, and gallbladder smooth muscles. PHM and PHV-related peptides also have vasodilatory properties. VIP Protein, Human (HEK293, His) is the recombinant human-derived VIP protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

VIP Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vip-protein-human-hek-293-his.html

Purity

98.0

Smiles

SQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNG

Molecular Formula

7432 (Gene_ID) P01282-2 (S21-G152) (Accession)

Molecular Weight

Approximately 17-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCMV-C-Myc-Zeo
D2788-1μg 1 μg

PCMV-C-Myc-Zeo

Sign In for Pricing
View Details
Tissue Total RNA, Myometrium
CR561122 5 µg

Tissue Total RNA, Myometrium

Sign In for Pricing
View Details
Human CD41/ITGA2B & CD61/ITGB3 Antibody , PE
E55A10180 50 Tests

Human CD41/ITGA2B & CD61/ITGB3 Antibody , PE

Sign In for Pricing
View Details
Recombinant Bordetella pertussis UPF0250 protein BP0104 (BP0104)
MBS1446459-01 0.02 mg (E-Coli)

Recombinant Bordetella pertussis UPF0250 protein BP0104 (BP0104)

Sign In for Pricing
View Details
Recombinant Bordetella pertussis UPF0250 protein BP0104 (BP0104)
MBS1446459-02 0.1 mg (E-Coli)

Recombinant Bordetella pertussis UPF0250 protein BP0104 (BP0104)

Sign In for Pricing
View Details
Recombinant Bordetella pertussis UPF0250 protein BP0104 (BP0104)
MBS1446459-03 0.02 mg (Yeast)

Recombinant Bordetella pertussis UPF0250 protein BP0104 (BP0104)

Sign In for Pricing
View Details