Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VIP, Human (HEK293, His)

VIP is a neuropeptide that induces vasodilation, lowers arterial blood pressure, stimulates myocardial contractility, enhances glycogenolysis, and relaxes tracheal, gastric, and gallbladder smooth muscles. PHM and PHV-related peptides also have vasodilatory properties. VIP Protein, Human (HEK293, His) is the recombinant human-derived VIP protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

VIP Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vip-protein-human-hek-293-his.html

Purity

98.0

Smiles

SQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNG

Molecular Formula

7432 (Gene_ID) P01282-2 (S21-G152) (Accession)

Molecular Weight

Approximately 17-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP6V0D1 Rabbit Monoclonal Antibody [Clone ID: R07-1A5]
TA383786 100 µL

ATP6V0D1 Rabbit Monoclonal Antibody [Clone ID: R07-1A5]

Sign In for Pricing
View Details
RAB3A Mouse Monoclonal Antibody [Clone ID: LBI1G4]
AMM19069V 100 µL

RAB3A Mouse Monoclonal Antibody [Clone ID: LBI1G4]

Sign In for Pricing
View Details
1-Cbz-Azetidine-3-CH2NH2
HY-W058001 100 mg

1-Cbz-Azetidine-3-CH2NH2

Sign In for Pricing
View Details
1-Ethyl-2,3-dimethylimidazolium tetrafluoroborate
IL-0001-HP-BULK 1 Each

1-Ethyl-2,3-dimethylimidazolium tetrafluoroborate

Sign In for Pricing
View Details
TRAF6 (TNF Receptor-associated Factor 6, MGC:3310, RNF85) (APC)
MBS6441589-01 0.1 mL

TRAF6 (TNF Receptor-associated Factor 6, MGC:3310, RNF85) (APC)

Sign In for Pricing
View Details
TRAF6 (TNF Receptor-associated Factor 6, MGC:3310, RNF85) (APC)
MBS6441589-02 5x 0.1 mL

TRAF6 (TNF Receptor-associated Factor 6, MGC:3310, RNF85) (APC)

Sign In for Pricing
View Details