Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VIP, Human (HEK293, His)

VIP is a neuropeptide that induces vasodilation, lowers arterial blood pressure, stimulates myocardial contractility, enhances glycogenolysis, and relaxes tracheal, gastric, and gallbladder smooth muscles. PHM and PHV-related peptides also have vasodilatory properties. VIP Protein, Human (HEK293, His) is the recombinant human-derived VIP protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

VIP Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vip-protein-human-hek-293-his.html

Purity

98.0

Smiles

SQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNG

Molecular Formula

7432 (Gene_ID) P01282-2 (S21-G152) (Accession)

Molecular Weight

Approximately 17-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat MMP7 Protein, His, Yeast-500ug
QP6371-ye-500ug 500ug

Recombinant Rat MMP7 Protein, His, Yeast-500ug

Sign In for Pricing
View Details
Upadacitinib Impurity 127
RM-U220127-01 10 mg

Upadacitinib Impurity 127

Sign In for Pricing
View Details
Upadacitinib Impurity 127
RM-U220127-02 25 mg

Upadacitinib Impurity 127

Sign In for Pricing
View Details
Upadacitinib Impurity 127
RM-U220127-03 50 mg

Upadacitinib Impurity 127

Sign In for Pricing
View Details
Upadacitinib Impurity 127
RM-U220127-04 100 mg

Upadacitinib Impurity 127

Sign In for Pricing
View Details
Fmo2 (NM_144737) Rat Tagged ORF Clone Lentiviral Particle
RR204302L3V 200 µL

Fmo2 (NM_144737) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details