Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VIP, Human (HEK293, His)

VIP is a neuropeptide that induces vasodilation, lowers arterial blood pressure, stimulates myocardial contractility, enhances glycogenolysis, and relaxes tracheal, gastric, and gallbladder smooth muscles. PHM and PHV-related peptides also have vasodilatory properties. VIP Protein, Human (HEK293, His) is the recombinant human-derived VIP protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

VIP Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vip-protein-human-hek-293-his.html

Purity

98.0

Smiles

SQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNG

Molecular Formula

7432 (Gene_ID) P01282-2 (S21-G152) (Accession)

Molecular Weight

Approximately 17-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC47 Protein, Human, Recombinant (His Tag)
MBS8121363-01 0.1 mg

CCDC47 Protein, Human, Recombinant (His Tag)

Sign In for Pricing
View Details
CCDC47 Protein, Human, Recombinant (His Tag)
MBS8121363-02 5x 0.1 mg

CCDC47 Protein, Human, Recombinant (His Tag)

Sign In for Pricing
View Details
DPEP3 3'UTR Luciferase Stable Cell Line
TU006263 1.0 mL

DPEP3 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Human RPS17 Protein - (Dry Ice)
H00006218-P01-2ug 2 µg

Recombinant Human RPS17 Protein - (Dry Ice)

Sign In for Pricing
View Details
PARD3A Polyclonal Antibody
RA28521-01 50 µL

PARD3A Polyclonal Antibody

Sign In for Pricing
View Details
PARD3A Polyclonal Antibody
RA28521-02 100 µL

PARD3A Polyclonal Antibody

Sign In for Pricing
View Details