Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VIP, Human (HEK293, His)

VIP is a neuropeptide that induces vasodilation, lowers arterial blood pressure, stimulates myocardial contractility, enhances glycogenolysis, and relaxes tracheal, gastric, and gallbladder smooth muscles. PHM and PHV-related peptides also have vasodilatory properties. VIP Protein, Human (HEK293, His) is the recombinant human-derived VIP protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

VIP Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vip-protein-human-hek-293-his.html

Purity

98.0

Smiles

SQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNG

Molecular Formula

7432 (Gene_ID) P01282-2 (S21-G152) (Accession)

Molecular Weight

Approximately 17-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Actin, alpha skeletal muscle (ACTA1) Antibody
abx402232-01 50 µL

Actin, alpha skeletal muscle (ACTA1) Antibody

Sign In for Pricing
View Details
Actin, alpha skeletal muscle (ACTA1) Antibody
abx402232-02 100 µL

Actin, alpha skeletal muscle (ACTA1) Antibody

Sign In for Pricing
View Details
RPS17P2 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV783592 1.0 µg DNA

RPS17P2 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
pCMV-SPORT6-TRIM9 Plasmid
PVT35123 2 µg

pCMV-SPORT6-TRIM9 Plasmid

Sign In for Pricing
View Details
Vps37a sgRNA CRISPR Lentivector set (Rat)
K7378201 3x 1.0 µg

Vps37a sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Lentiviral human CAST shRNA (UAS) - Lentiviral human CAST shRNA (UAS) (100)
GTR15090654 1 Vial

Lentiviral human CAST shRNA (UAS) - Lentiviral human CAST shRNA (UAS) (100)

Sign In for Pricing
View Details