Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VIP, Human (HEK293, His)

VIP is a neuropeptide that induces vasodilation, lowers arterial blood pressure, stimulates myocardial contractility, enhances glycogenolysis, and relaxes tracheal, gastric, and gallbladder smooth muscles. PHM and PHV-related peptides also have vasodilatory properties. VIP Protein, Human (HEK293, His) is the recombinant human-derived VIP protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

VIP Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vip-protein-human-hek-293-his.html

Purity

98.0

Smiles

SQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNG

Molecular Formula

7432 (Gene_ID) P01282-2 (S21-G152) (Accession)

Molecular Weight

Approximately 17-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ttc23 (NM_001168477) Mouse Untagged Clone
MC210469 10 µg

Ttc23 (NM_001168477) Mouse Untagged Clone

Sign In for Pricing
View Details
SAE1, CT (SUMO-activating Enzyme Subunit 1, Ubiquitin-like 1-activating Enzyme E1A, AOS1, SUA1, UBLE1A) (AP) discontinued
S8025-85L-AP 200 µL

SAE1, CT (SUMO-activating Enzyme Subunit 1, Ubiquitin-like 1-activating Enzyme E1A, AOS1, SUA1, UBLE1A) (AP) discontinued

Sign In for Pricing
View Details
Mouse Monoclonal TRAP1 Antibody (3H4-2H6) [Biotin]
NBP2-59343B 100 µL

Mouse Monoclonal TRAP1 Antibody (3H4-2H6) [Biotin]

Sign In for Pricing
View Details
Copper (Metal) Powder 98% Electrolytic (325 Mesh)
00851 00500 500 g

Copper (Metal) Powder 98% Electrolytic (325 Mesh)

Sign In for Pricing
View Details
FXN (Frataxin, Mitochondrial, Frataxin)
481429 100 µL

FXN (Frataxin, Mitochondrial, Frataxin)

Sign In for Pricing
View Details
Recombinant Human STK3 Protein, N-His
MBS1577294-01 0.1 mg

Recombinant Human STK3 Protein, N-His

Sign In for Pricing
View Details