Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VIP, Human (HEK293, His)

VIP is a neuropeptide that induces vasodilation, lowers arterial blood pressure, stimulates myocardial contractility, enhances glycogenolysis, and relaxes tracheal, gastric, and gallbladder smooth muscles. PHM and PHV-related peptides also have vasodilatory properties. VIP Protein, Human (HEK293, His) is the recombinant human-derived VIP protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

VIP Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vip-protein-human-hek-293-his.html

Purity

98.0

Smiles

SQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNG

Molecular Formula

7432 (Gene_ID) P01282-2 (S21-G152) (Accession)

Molecular Weight

Approximately 17-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

METTL21C sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2783708 1.0 µg DNA

METTL21C sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Lentiviral human FBL shRNA (UAS) - Lentiviral human FBL shRNA (UAS, RFP) plasmid
GTR15097981 1 Vial

Lentiviral human FBL shRNA (UAS) - Lentiviral human FBL shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
4-Chloro-N-Methyl-N-phenyl-2- (2-pyrrolyl) butanamide
431821 25 mg

4-Chloro-N-Methyl-N-phenyl-2- (2-pyrrolyl) butanamide

Sign In for Pricing
View Details
LEO1 3'UTR Luciferase Stable Cell Line
TU012385 1.0 mL

LEO1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Srp68 (NM_001108840) Rat Tagged Lenti ORF Clone
RR207022L4 10 µg

Srp68 (NM_001108840) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) PUR3 Polyclonal Antibody
MBS7160221 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) PUR3 Polyclonal Antibody

Sign In for Pricing
View Details