Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VIP, Human (HEK293, His)

VIP is a neuropeptide that induces vasodilation, lowers arterial blood pressure, stimulates myocardial contractility, enhances glycogenolysis, and relaxes tracheal, gastric, and gallbladder smooth muscles. PHM and PHV-related peptides also have vasodilatory properties. VIP Protein, Human (HEK293, His) is the recombinant human-derived VIP protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

VIP Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vip-protein-human-hek-293-his.html

Purity

98.0

Smiles

SQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNG

Molecular Formula

7432 (Gene_ID) P01282-2 (S21-G152) (Accession)

Molecular Weight

Approximately 17-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HERC4 (BC015043) Human Untagged Clone
SC314714 10 µg

HERC4 (BC015043) Human Untagged Clone

Sign In for Pricing
View Details
Lentiviral mouse Acvr2a shRNA (UAS) - Lentiviral mouse Acvr2a shRNA (UAS) (25)
GTR15187505 1 Vial

Lentiviral mouse Acvr2a shRNA (UAS) - Lentiviral mouse Acvr2a shRNA (UAS) (25)

Sign In for Pricing
View Details
HOXB3 3'UTR GFP Stable Cell Line
TU060087 1.0 mL

HOXB3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Prss29 Recombinant Protein (Mouse)
RP165023 100 µg

Prss29 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
DPPL2 CRISPR Activation Plasmid (h2)
sc-414952-ACT-2 20 µg

DPPL2 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
Mouse C-X-C Motif Chemokine 16 (CXCL16) Protein
abx658018-01 10 µg

Mouse C-X-C Motif Chemokine 16 (CXCL16) Protein

Sign In for Pricing
View Details