Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VIP, Human (HEK293, His)

VIP is a neuropeptide that induces vasodilation, lowers arterial blood pressure, stimulates myocardial contractility, enhances glycogenolysis, and relaxes tracheal, gastric, and gallbladder smooth muscles. PHM and PHV-related peptides also have vasodilatory properties. VIP Protein, Human (HEK293, His) is the recombinant human-derived VIP protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

VIP Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vip-protein-human-hek-293-his.html

Purity

98.0

Smiles

SQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNG

Molecular Formula

7432 (Gene_ID) P01282-2 (S21-G152) (Accession)

Molecular Weight

Approximately 17-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRAPPC5 (NM_001042462) Human 3' UTR Clone
SC200123 10 µg

TRAPPC5 (NM_001042462) Human 3' UTR Clone

Sign In for Pricing
View Details
FTH1P14 Protein Vector (Human) (pPB-N-His)
PV079522 500 ng

FTH1P14 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
DET1 rabbit pAb
RA24181-01 50 µL

DET1 rabbit pAb

Sign In for Pricing
View Details
DET1 rabbit pAb
RA24181-02 100 µL

DET1 rabbit pAb

Sign In for Pricing
View Details
HLA 6 Genes Panel
PH2007805-01 24 Reactions

HLA 6 Genes Panel

Sign In for Pricing
View Details
HLA 6 Genes Panel
PH2007805-02 24 Reactions

HLA 6 Genes Panel

Sign In for Pricing
View Details