Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VIP, Human (HEK293, His)

VIP is a neuropeptide that induces vasodilation, lowers arterial blood pressure, stimulates myocardial contractility, enhances glycogenolysis, and relaxes tracheal, gastric, and gallbladder smooth muscles. PHM and PHV-related peptides also have vasodilatory properties. VIP Protein, Human (HEK293, His) is the recombinant human-derived VIP protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

VIP Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vip-protein-human-hek-293-his.html

Purity

98.0

Smiles

SQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNG

Molecular Formula

7432 (Gene_ID) P01282-2 (S21-G152) (Accession)

Molecular Weight

Approximately 17-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Comp activation kit by CRISPRa
GA200831 1 Kit

Mouse Comp activation kit by CRISPRa

Sign In for Pricing
View Details
IGF 1 Recombinant Antibody, PerCP-Cy5.5 Conjugated
bsm-61189R-PerCP-Cy5.5 100 µL

IGF 1 Recombinant Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
BCL10 Mouse Monoclonal Antibody [Clone ID: LBI4G4]
AMM14596V 100 µL

BCL10 Mouse Monoclonal Antibody [Clone ID: LBI4G4]

Sign In for Pricing
View Details
KIAA0649 (PPP1R26) (NM_014811) Human Over-expression Lysate
LY415020 100 µg

KIAA0649 (PPP1R26) (NM_014811) Human Over-expression Lysate

Sign In for Pricing
View Details
Rabbit Polyclonal CD5L Antibody [Alexa Fluor 750]
NBP1-76700AF750 0.1 mL

Rabbit Polyclonal CD5L Antibody [Alexa Fluor 750]

Sign In for Pricing
View Details
Influenza A H7N7 (A/Netherlands/219/2003) Neuraminidase/NA Antibody, Rabbit PAb
MBS8110626-01 0.02 mL

Influenza A H7N7 (A/Netherlands/219/2003) Neuraminidase/NA Antibody, Rabbit PAb

Sign In for Pricing
View Details