Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VIP, Human (HEK293, His)

VIP is a neuropeptide that induces vasodilation, lowers arterial blood pressure, stimulates myocardial contractility, enhances glycogenolysis, and relaxes tracheal, gastric, and gallbladder smooth muscles. PHM and PHV-related peptides also have vasodilatory properties. VIP Protein, Human (HEK293, His) is the recombinant human-derived VIP protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

VIP Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vip-protein-human-hek-293-his.html

Purity

98.0

Smiles

SQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNG

Molecular Formula

7432 (Gene_ID) P01282-2 (S21-G152) (Accession)

Molecular Weight

Approximately 17-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse NUF2 Protein, His (Fc)-Avi-tagged
NUF2-6264M 50 µg

Recombinant Mouse NUF2 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
CXorf49B sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0539205 3x 1.0 µg

CXorf49B sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
TMEM111 sgRNA CRISPR Lentivector (Human) (Target 1)
K2396802 1.0 µg DNA

TMEM111 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
1600015I10Rik Protein Vector (Mouse) (pPM-C-HA)
PV146660 500 ng

1600015I10Rik Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Microcystis aeruginosa Proline--tRNA ligase (proS)
MBS1189176-01 1 mg (E-Coli)

Recombinant Microcystis aeruginosa Proline--tRNA ligase (proS)

Sign In for Pricing
View Details
Recombinant Microcystis aeruginosa Proline--tRNA ligase (proS)
MBS1189176-02 1 mg (Yeast)

Recombinant Microcystis aeruginosa Proline--tRNA ligase (proS)

Sign In for Pricing
View Details