Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VIP, Human (HEK293, His)

VIP is a neuropeptide that induces vasodilation, lowers arterial blood pressure, stimulates myocardial contractility, enhances glycogenolysis, and relaxes tracheal, gastric, and gallbladder smooth muscles. PHM and PHV-related peptides also have vasodilatory properties. VIP Protein, Human (HEK293, His) is the recombinant human-derived VIP protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

VIP Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vip-protein-human-hek-293-his.html

Purity

98.0

Smiles

SQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNG

Molecular Formula

7432 (Gene_ID) P01282-2 (S21-G152) (Accession)

Molecular Weight

Approximately 17-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CXCL4 (Chemokine C-X-C-Motif Ligand 4, PF4)
216414 50 µg

CXCL4 (Chemokine C-X-C-Motif Ligand 4, PF4)

Sign In for Pricing
View Details
Cystatin C (AD8, Amyloid Angiopathy and Cerebral Hemorrhage, Cst3, Cystatin 3, Gamma Trace, HCCAA, Neuroendocrine Basic Polypeptide, Post gamma Globulin, ARMD11, MGC117328, OTTHUMP00000030440, OTTHUMP00000164181, bA218C14.4)
C8950-01B 1 mg

Cystatin C (AD8, Amyloid Angiopathy and Cerebral Hemorrhage, Cst3, Cystatin 3, Gamma Trace, HCCAA, Neuroendocrine Basic Polypeptide, Post gamma Globulin, ARMD11, MGC117328, OTTHUMP00000030440, OTTHUMP00000164181, bA218C14.4)

Sign In for Pricing
View Details
pGEX-KG Plasmid
PVTY01088 2 µg

pGEX-KG Plasmid

Sign In for Pricing
View Details
Recombinant Bovine PRA1 family protein 3 (ARL6IP5)
MBS7007997-01 0.02 mg

Recombinant Bovine PRA1 family protein 3 (ARL6IP5)

Sign In for Pricing
View Details
Recombinant Bovine PRA1 family protein 3 (ARL6IP5)
MBS7007997-02 0.1 mg

Recombinant Bovine PRA1 family protein 3 (ARL6IP5)

Sign In for Pricing
View Details
Recombinant Bovine PRA1 family protein 3 (ARL6IP5)
MBS7007997-03 5x 0.1 mg

Recombinant Bovine PRA1 family protein 3 (ARL6IP5)

Sign In for Pricing
View Details