Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VIP, Human (HEK293, His)

VIP is a neuropeptide that induces vasodilation, lowers arterial blood pressure, stimulates myocardial contractility, enhances glycogenolysis, and relaxes tracheal, gastric, and gallbladder smooth muscles. PHM and PHV-related peptides also have vasodilatory properties. VIP Protein, Human (HEK293, His) is the recombinant human-derived VIP protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

VIP Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vip-protein-human-hek-293-his.html

Purity

98.0

Smiles

SQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNG

Molecular Formula

7432 (Gene_ID) P01282-2 (S21-G152) (Accession)

Molecular Weight

Approximately 17-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Methyl-1-propylpyrrolidinium bis (trifluoromethylsulfonyl) imide
IL-0044-HP-1000 1 Kg

1-Methyl-1-propylpyrrolidinium bis (trifluoromethylsulfonyl) imide

Sign In for Pricing
View Details
PD-1/PD-L1 inhibitor 1
MBS578522 Inquire

PD-1/PD-L1 inhibitor 1

Sign In for Pricing
View Details
Rdh1 (NM_080436) Mouse Tagged Lenti ORF Clone
MR215230L4 10 µg

Rdh1 (NM_080436) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
BNC2 discontinued
507309 100 µg

BNC2 discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal YPEL3 Antibody [DyLight 755]
NBP2-81867IR 0.1 mL

Rabbit Polyclonal YPEL3 Antibody [DyLight 755]

Sign In for Pricing
View Details
Anti-IL-18 Antibody (GSK 1070806)
F1255-5 5 mg

Anti-IL-18 Antibody (GSK 1070806)

Sign In for Pricing
View Details