Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VIP, Human (HEK293, His)

VIP is a neuropeptide that induces vasodilation, lowers arterial blood pressure, stimulates myocardial contractility, enhances glycogenolysis, and relaxes tracheal, gastric, and gallbladder smooth muscles. PHM and PHV-related peptides also have vasodilatory properties. VIP Protein, Human (HEK293, His) is the recombinant human-derived VIP protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

VIP Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vip-protein-human-hek-293-his.html

Purity

98.0

Smiles

SQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNG

Molecular Formula

7432 (Gene_ID) P01282-2 (S21-G152) (Accession)

Molecular Weight

Approximately 17-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse NADPH oxidase 3 (NOX3) ELISA Kit
AE60299MO-01 48 Tests

Mouse NADPH oxidase 3 (NOX3) ELISA Kit

Sign In for Pricing
View Details
Mouse NADPH oxidase 3 (NOX3) ELISA Kit
AE60299MO-02 96 Tests

Mouse NADPH oxidase 3 (NOX3) ELISA Kit

Sign In for Pricing
View Details
[Des-His1, Glu9]-Glucagon amide
HY-P1143 1 Each

[Des-His1, Glu9]-Glucagon amide

Sign In for Pricing
View Details
B230120H23Rik Protein Vector (Mouse) (pPM-C-HA)
PV157924 500 ng

B230120H23Rik Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
KRT81 (Keratin, Type II Cuticular Hb1, Hair Keratin K2.9, Keratin, Hair, Basic, 1, Keratin-81, K81, Metastatic Lymph Node 137 Gene Protein, MLN 137, Type II Hair Keratin Hb1, Type-II Keratin Kb21, ghHKb1, ghHb1, KRTHB1, MLN137) (MaxLight 750)
MBS6383980-01 0.1 mL

KRT81 (Keratin, Type II Cuticular Hb1, Hair Keratin K2.9, Keratin, Hair, Basic, 1, Keratin-81, K81, Metastatic Lymph Node 137 Gene Protein, MLN 137, Type II Hair Keratin Hb1, Type-II Keratin Kb21, ghHKb1, ghHb1, KRTHB1, MLN137) (MaxLight 750)

Sign In for Pricing
View Details
KRT81 (Keratin, Type II Cuticular Hb1, Hair Keratin K2.9, Keratin, Hair, Basic, 1, Keratin-81, K81, Metastatic Lymph Node 137 Gene Protein, MLN 137, Type II Hair Keratin Hb1, Type-II Keratin Kb21, ghHKb1, ghHb1, KRTHB1, MLN137) (MaxLight 750)
MBS6383980-02 5x 0.1 mL

KRT81 (Keratin, Type II Cuticular Hb1, Hair Keratin K2.9, Keratin, Hair, Basic, 1, Keratin-81, K81, Metastatic Lymph Node 137 Gene Protein, MLN 137, Type II Hair Keratin Hb1, Type-II Keratin Kb21, ghHKb1, ghHb1, KRTHB1, MLN137) (MaxLight 750)

Sign In for Pricing
View Details