Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VIP, Human (HEK293, His)

VIP is a neuropeptide that induces vasodilation, lowers arterial blood pressure, stimulates myocardial contractility, enhances glycogenolysis, and relaxes tracheal, gastric, and gallbladder smooth muscles. PHM and PHV-related peptides also have vasodilatory properties. VIP Protein, Human (HEK293, His) is the recombinant human-derived VIP protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

VIP Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vip-protein-human-hek-293-his.html

Purity

98.0

Smiles

SQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNG

Molecular Formula

7432 (Gene_ID) P01282-2 (S21-G152) (Accession)

Molecular Weight

Approximately 17-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PVDF Membrane
OM790013 10 Each

PVDF Membrane

Sign In for Pricing
View Details
DGK-κ Polyclonal Antibody
UB-GEN-14494 100 µL

DGK-κ Polyclonal Antibody

Sign In for Pricing
View Details
Sh2b2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
43648114 3x 1.0 µg

Sh2b2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Cephapirin Benzathine
MF-0009685-01 500 mg

Cephapirin Benzathine

Sign In for Pricing
View Details
Cephapirin Benzathine
MF-0009685-02 1 mL - 10 mM (in DMSO)

Cephapirin Benzathine

Sign In for Pricing
View Details
Cephapirin Benzathine
MF-0009685-03 1 g

Cephapirin Benzathine

Sign In for Pricing
View Details