Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VIP, Human (HEK293, His)

VIP is a neuropeptide that induces vasodilation, lowers arterial blood pressure, stimulates myocardial contractility, enhances glycogenolysis, and relaxes tracheal, gastric, and gallbladder smooth muscles. PHM and PHV-related peptides also have vasodilatory properties. VIP Protein, Human (HEK293, His) is the recombinant human-derived VIP protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

VIP Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vip-protein-human-hek-293-his.html

Purity

98.0

Smiles

SQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNG

Molecular Formula

7432 (Gene_ID) P01282-2 (S21-G152) (Accession)

Molecular Weight

Approximately 17-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human C11orf94 shRNA (UAS) - Lentiviral human C11orf94 shRNA (UAS, GFP) (25)
GTR15146336 1 Vial

Lentiviral human C11orf94 shRNA (UAS) - Lentiviral human C11orf94 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Irak3 (NM_001108101) Rat Untagged Clone
RN201063 10 µg

Irak3 (NM_001108101) Rat Untagged Clone

Sign In for Pricing
View Details
Olr562 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K7406708 1.0 µg DNA

Olr562 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
RPS15 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
42104154 3x 1.0 µg DNA

RPS15 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Atp8a1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3958405 3x 1.0 µg

Atp8a1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Pig CLDN3 (Claudin 3) ELISA Kit
EK249003 96 Well

Pig CLDN3 (Claudin 3) ELISA Kit

Sign In for Pricing
View Details