VIP, Human (HEK293, His)
VIP is a neuropeptide that induces vasodilation, lowers arterial blood pressure, stimulates myocardial contractility, enhances glycogenolysis, and relaxes tracheal, gastric, and gallbladder smooth muscles. PHM and PHV-related peptides also have vasodilatory properties. VIP Protein, Human (HEK293, His) is the recombinant human-derived VIP protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
VIP Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/vip-protein-human-hek-293-his.html
Purity
98.0
Smiles
SQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNG
Molecular Formula
7432 (Gene_ID) P01282-2 (S21-G152) (Accession)
Molecular Weight
Approximately 17-30 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
![Rabbit Polyclonal NDUFB8 Antibody [DyLight 680]](https://cdn.genprice.uk/genprice/uk/genprice3.webp)
Rabbit Polyclonal NDUFB8 Antibody [DyLight 680]
GTPBP8 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
TLR6, CT (Toll-like Receptor 6, CD286) (MaxLight 650)
TLR6, CT (Toll-like Receptor 6, CD286) (MaxLight 650)
NDST4 (HSST4, Bifunctional Heparan Sulfate N-deacetylase/N-sulfotransferase 4, Glucosaminyl N-deacetylase/N-sulfotransferase 4, N-heparan Sulfate Sulfotransferase 4, Heparan Sulfate N-deacetylase 4, Heparan Sulfate N-sulfotransferase 4) (MaxLight 490)