Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VIP, Human (HEK293, His)

VIP is a neuropeptide that induces vasodilation, lowers arterial blood pressure, stimulates myocardial contractility, enhances glycogenolysis, and relaxes tracheal, gastric, and gallbladder smooth muscles. PHM and PHV-related peptides also have vasodilatory properties. VIP Protein, Human (HEK293, His) is the recombinant human-derived VIP protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

VIP Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vip-protein-human-hek-293-his.html

Purity

98.0

Smiles

SQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNG

Molecular Formula

7432 (Gene_ID) P01282-2 (S21-G152) (Accession)

Molecular Weight

Approximately 17-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey Tyrosine-Protein Kinase Fer (FER) ELISA Kit
MBS9908558-01 48 Well

Monkey Tyrosine-Protein Kinase Fer (FER) ELISA Kit

Sign In for Pricing
View Details
Monkey Tyrosine-Protein Kinase Fer (FER) ELISA Kit
MBS9908558-02 96 Well

Monkey Tyrosine-Protein Kinase Fer (FER) ELISA Kit

Sign In for Pricing
View Details
Monkey Tyrosine-Protein Kinase Fer (FER) ELISA Kit
MBS9908558-03 5x 96 Well

Monkey Tyrosine-Protein Kinase Fer (FER) ELISA Kit

Sign In for Pricing
View Details
Monkey Tyrosine-Protein Kinase Fer (FER) ELISA Kit
MBS9908558-04 10x 96 Well

Monkey Tyrosine-Protein Kinase Fer (FER) ELISA Kit

Sign In for Pricing
View Details
OR4A3P sgRNA CRISPR Lentivector set (Human)
K1501801 3x 1.0 µg

OR4A3P sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
TBC1D26, CT (TBC1D26, TBC1 domain family member 26) (FITC) discontinued
042635-FITC 200 µL

TBC1D26, CT (TBC1D26, TBC1 domain family member 26) (FITC) discontinued

Sign In for Pricing
View Details