Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VIP, Human (HEK293, His)

VIP is a neuropeptide that induces vasodilation, lowers arterial blood pressure, stimulates myocardial contractility, enhances glycogenolysis, and relaxes tracheal, gastric, and gallbladder smooth muscles. PHM and PHV-related peptides also have vasodilatory properties. VIP Protein, Human (HEK293, His) is the recombinant human-derived VIP protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

VIP Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vip-protein-human-hek-293-his.html

Purity

98.0

Smiles

SQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNG

Molecular Formula

7432 (Gene_ID) P01282-2 (S21-G152) (Accession)

Molecular Weight

Approximately 17-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CD52 knockout cell line
ABC-KH2726 1 Vial

Human CD52 knockout cell line

Sign In for Pricing
View Details
Mouse H1f10 activation kit by CRISPRa
GA215131 1 Kit

Mouse H1f10 activation kit by CRISPRa

Sign In for Pricing
View Details
PSAP / MTCH1 Immunizing Peptide
MBS425201-01 0.1 mg

PSAP / MTCH1 Immunizing Peptide

Sign In for Pricing
View Details
PSAP / MTCH1 Immunizing Peptide
MBS425201-02 5x 0.1 mg

PSAP / MTCH1 Immunizing Peptide

Sign In for Pricing
View Details
GGT7 Recombinant Protein (Mouse)
RP136400 100 µg

GGT7 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
HES4 (NM_001142467) Human Recombinant Protein
TP327268L 1 mg

HES4 (NM_001142467) Human Recombinant Protein

Sign In for Pricing
View Details