Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VIP, Human (HEK293, His)

VIP is a neuropeptide that induces vasodilation, lowers arterial blood pressure, stimulates myocardial contractility, enhances glycogenolysis, and relaxes tracheal, gastric, and gallbladder smooth muscles. PHM and PHV-related peptides also have vasodilatory properties. VIP Protein, Human (HEK293, His) is the recombinant human-derived VIP protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

VIP Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vip-protein-human-hek-293-his.html

Purity

98.0

Smiles

SQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNG

Molecular Formula

7432 (Gene_ID) P01282-2 (S21-G152) (Accession)

Molecular Weight

Approximately 17-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Survivin Antibody
NB100-56167 0.05 mL

Rabbit Polyclonal Survivin Antibody

Sign In for Pricing
View Details
Leukotriene A4 hydrolase (LTA4H) Mouse Monoclonal Antibody [Clone ID: OTI3C11]
TA500664 100 µL

Leukotriene A4 hydrolase (LTA4H) Mouse Monoclonal Antibody [Clone ID: OTI3C11]

Sign In for Pricing
View Details
HAND2 (Heart and Neural Crest Derivatives Expressed 2, DHAND2, FLJ16260, Hed, MGC125303, MGC125304, Thing2, bHLHa26, dHand) (MaxLight 650)
246906-ML650 100 µL

HAND2 (Heart and Neural Crest Derivatives Expressed 2, DHAND2, FLJ16260, Hed, MGC125303, MGC125304, Thing2, bHLHa26, dHand) (MaxLight 650)

Sign In for Pricing
View Details
A4GALT Antibody
MBS8595430-01 0.1 mg

A4GALT Antibody

Sign In for Pricing
View Details
A4GALT Antibody
MBS8595430-02 0.1 mL (AF405L)

A4GALT Antibody

Sign In for Pricing
View Details
A4GALT Antibody
MBS8595430-03 0.1 mL (AF405S)

A4GALT Antibody

Sign In for Pricing
View Details