VIP, Human (HEK293, His)
VIP is a neuropeptide that induces vasodilation, lowers arterial blood pressure, stimulates myocardial contractility, enhances glycogenolysis, and relaxes tracheal, gastric, and gallbladder smooth muscles. PHM and PHV-related peptides also have vasodilatory properties. VIP Protein, Human (HEK293, His) is the recombinant human-derived VIP protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
VIP Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/vip-protein-human-hek-293-his.html
Purity
98.0
Smiles
SQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNG
Molecular Formula
7432 (Gene_ID) P01282-2 (S21-G152) (Accession)
Molecular Weight
Approximately 17-30 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
Lentiviral human OLIG3 shRNA (UAS) - Lentiviral human OLIG3 shRNA (UAS, iRFP) plasmid
![Cbl c (CBLC) Mouse Monoclonal Antibody [Clone ID: OTI3D9]](https://cdn.genprice.uk/genprice/uk/genprice4.webp)
Cbl c (CBLC) Mouse Monoclonal Antibody [Clone ID: OTI3D9]
FGFR2, CT (Fibroblast Growth Factor Receptor 2, FGFR-2, Keratinocyte Growth Factor Receptor, K-sam, CD332, BEK, KGFR, KSAM) (MaxLight 750)
FGFR2, CT (Fibroblast Growth Factor Receptor 2, FGFR-2, Keratinocyte Growth Factor Receptor, K-sam, CD332, BEK, KGFR, KSAM) (MaxLight 750)
A330070K13Rik Mouse shRNA Lentiviral Particle (Locus ID 381673)