Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VIP, Human (HEK293, His)

VIP is a neuropeptide that induces vasodilation, lowers arterial blood pressure, stimulates myocardial contractility, enhances glycogenolysis, and relaxes tracheal, gastric, and gallbladder smooth muscles. PHM and PHV-related peptides also have vasodilatory properties. VIP Protein, Human (HEK293, His) is the recombinant human-derived VIP protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

VIP Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vip-protein-human-hek-293-his.html

Purity

98.0

Smiles

SQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNG

Molecular Formula

7432 (Gene_ID) P01282-2 (S21-G152) (Accession)

Molecular Weight

Approximately 17-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Epgn 3'UTR GFP Stable Cell Line
TU155865 1.0 mL

Epgn 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Tssk3 3'UTR Luciferase Stable Cell Line
TU222580 1.0 mL

Tssk3 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant AAV-8 VP3 Protein, His-tagged
VP3-318A 10 µg

Recombinant AAV-8 VP3 Protein, His-tagged

Sign In for Pricing
View Details
NCTC clone 929 Luciferase Stable Cell Line
ARG0638 1 Million

NCTC clone 929 Luciferase Stable Cell Line

Sign In for Pricing
View Details
TPST1, CT (TPST1, Protein-tyrosine sulfotransferase 1, Tyrosylprotein sulfotransferase 1) (MaxLight 750)
MBS6357767-01 0.1 mL

TPST1, CT (TPST1, Protein-tyrosine sulfotransferase 1, Tyrosylprotein sulfotransferase 1) (MaxLight 750)

Sign In for Pricing
View Details
TPST1, CT (TPST1, Protein-tyrosine sulfotransferase 1, Tyrosylprotein sulfotransferase 1) (MaxLight 750)
MBS6357767-02 5x 0.1 mL

TPST1, CT (TPST1, Protein-tyrosine sulfotransferase 1, Tyrosylprotein sulfotransferase 1) (MaxLight 750)

Sign In for Pricing
View Details