Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VIP, Human (HEK293, His)

VIP is a neuropeptide that induces vasodilation, lowers arterial blood pressure, stimulates myocardial contractility, enhances glycogenolysis, and relaxes tracheal, gastric, and gallbladder smooth muscles. PHM and PHV-related peptides also have vasodilatory properties. VIP Protein, Human (HEK293, His) is the recombinant human-derived VIP protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

VIP Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vip-protein-human-hek-293-his.html

Purity

98.0

Smiles

SQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNG

Molecular Formula

7432 (Gene_ID) P01282-2 (S21-G152) (Accession)

Molecular Weight

Approximately 17-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nckap1 3'UTR GFP Stable Cell Line
TU263784 1.0 mL

Nckap1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Q Focurose HF
HL280306001E 1 mL

Q Focurose HF

Sign In for Pricing
View Details
Giardia lamblia (AP) discontinued
G2034-17-AP 100 µL

Giardia lamblia (AP) discontinued

Sign In for Pricing
View Details
SLC25A13 Antibody
A39914-100UL 100 µL

SLC25A13 Antibody

Sign In for Pricing
View Details
TNS1 Knockout U2OS Cell Line
ARG44176 1 Million

TNS1 Knockout U2OS Cell Line

Sign In for Pricing
View Details
Total ginsenosides from Radix Ginseng
M38761-01 100 mg

Total ginsenosides from Radix Ginseng

Sign In for Pricing
View Details