Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VIP, Human (HEK293, His)

VIP is a neuropeptide that induces vasodilation, lowers arterial blood pressure, stimulates myocardial contractility, enhances glycogenolysis, and relaxes tracheal, gastric, and gallbladder smooth muscles. PHM and PHV-related peptides also have vasodilatory properties. VIP Protein, Human (HEK293, His) is the recombinant human-derived VIP protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

VIP Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vip-protein-human-hek-293-his.html

Purity

98.0

Smiles

SQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNG

Molecular Formula

7432 (Gene_ID) P01282-2 (S21-G152) (Accession)

Molecular Weight

Approximately 17-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal FAM9B Antibody [PerCP]
NBP2-98161PCP 0.1 mL

Rabbit Polyclonal FAM9B Antibody [PerCP]

Sign In for Pricing
View Details
HAS3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0930008 1.0 µg DNA

HAS3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
IFNA1 (Interferon alpha-1/13, IFN-alpha-1/13, Interferon alpha-D, LeIF D, IFNA13, MGC138207, MGC138505, MGC138507) (Not for Export EU)
128261 100 µL

IFNA1 (Interferon alpha-1/13, IFN-alpha-1/13, Interferon alpha-D, LeIF D, IFNA13, MGC138207, MGC138505, MGC138507) (Not for Export EU)

Sign In for Pricing
View Details
ISR (Insulin Receptor) Rabbit ELISA Kit
E4563 96 Tests

ISR (Insulin Receptor) Rabbit ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal Draxin/C1orf187 Antibody [Biotin]
NBP2-97115B 0.1 mL

Rabbit Polyclonal Draxin/C1orf187 Antibody [Biotin]

Sign In for Pricing
View Details
Zfp238 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6968006 1.0 µg DNA

Zfp238 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details