Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free Neurturin, Mouse (His)

Neurturin, forming homodimers through disulfide links, promotes the survival of sympathetic neurons in culture.It potentially plays a role in regulating the development and maintenance of the central nervous system (CNS) and influencing the size of non-neuronal cell populations, such as haemopoietic cells.Animal-Free Neurturin Protein, Mouse (His) is the recombinant mouse-derived animal-FreeNeurturin protein, expressed by E.coli , with N-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free Neurturin Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-neurturin-protein-mouse-his.html

Purity

98.0

Smiles

PGARPCGLRELEVRVSELGLGYTSDETVLFRYCAGACEAAIRIYDLGLRRLRQRRRVRRERARAHPCCRPTAYEDEVSFLDVHSRYHTLQELSARECACV

Molecular Formula

18188 (Gene_ID) P97463.1 (P96-V195) (Accession)

Molecular Weight

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P27 / KIP1 (SX53G8), CF594 conjugate, 0.1mg/mL
BNC940669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF594 conjugate, 0.1mg/mL
BNC940322-100 1x 100 µL

CD3e (RIV9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF770 conjugate, 0.1mg/mL
BNC701052-100 1x 100 µL

CD3e (B-B12), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF405S conjugate, 0.1mg/mL
BNC040305-500 1x 500 µL

CD95 (B-R18), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF568 conjugate, 0.1mg/mL
BNC680861-500 1x 500 µL

HSP27 (G3.1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details