Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free Neurturin, Mouse (His)

Neurturin, forming homodimers through disulfide links, promotes the survival of sympathetic neurons in culture.It potentially plays a role in regulating the development and maintenance of the central nervous system (CNS) and influencing the size of non-neuronal cell populations, such as haemopoietic cells.Animal-Free Neurturin Protein, Mouse (His) is the recombinant mouse-derived animal-FreeNeurturin protein, expressed by E.coli , with N-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free Neurturin Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-neurturin-protein-mouse-his.html

Purity

98.0

Smiles

PGARPCGLRELEVRVSELGLGYTSDETVLFRYCAGACEAAIRIYDLGLRRLRQRRRVRRERARAHPCCRPTAYEDEVSFLDVHSRYHTLQELSARECACV

Molecular Formula

18188 (Gene_ID) P97463.1 (P96-V195) (Accession)

Molecular Weight

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGF-alpha (EGF-like TGF, ETGF, TFGA, TGF Type 1, TGFA, Wa1, Waved 1) (HRP)
172154-AF-HRP 100 µL

TGF-alpha (EGF-like TGF, ETGF, TFGA, TGF Type 1, TGFA, Wa1, Waved 1) (HRP)

Sign In for Pricing
View Details
Human PAH (Phenylalanine Hydroxylase) QuickTest ELISA Kit
QT-EH3498 96 Tests

Human PAH (Phenylalanine Hydroxylase) QuickTest ELISA Kit

Sign In for Pricing
View Details
Rat Wnt7a Pre-designed siRNA Set A
SI216018A 1 Each

Rat Wnt7a Pre-designed siRNA Set A

Sign In for Pricing
View Details
Snn sgRNA CRISPR Lentivector (Rat) (Target 3)
K6850604 1.0 µg DNA

Snn sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
RAB2B Overexpression Lysate (Native) - (Dry Ice)
NBL1-15058 0.1 mg

RAB2B Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
Human TMBIM4 siRNA
abx936951-01 15 nmol

Human TMBIM4 siRNA

Sign In for Pricing
View Details