Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free Neurturin, Mouse (His)

Neurturin, forming homodimers through disulfide links, promotes the survival of sympathetic neurons in culture.It potentially plays a role in regulating the development and maintenance of the central nervous system (CNS) and influencing the size of non-neuronal cell populations, such as haemopoietic cells.Animal-Free Neurturin Protein, Mouse (His) is the recombinant mouse-derived animal-FreeNeurturin protein, expressed by E.coli , with N-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free Neurturin Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-neurturin-protein-mouse-his.html

Purity

98.0

Smiles

PGARPCGLRELEVRVSELGLGYTSDETVLFRYCAGACEAAIRIYDLGLRRLRQRRRVRRERARAHPCCRPTAYEDEVSFLDVHSRYHTLQELSARECACV

Molecular Formula

18188 (Gene_ID) P97463.1 (P96-V195) (Accession)

Molecular Weight

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MECP2 Rabbit Polyclonal Antibody
TA350163 100 µL

MECP2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cinanserin
TRC-C441903-25MG 25 mg

Cinanserin

Sign In for Pricing
View Details
Lactate Dehydrogenase 4, Human Liver
MF-0127876-01 10 mg

Lactate Dehydrogenase 4, Human Liver

Sign In for Pricing
View Details
Lactate Dehydrogenase 4, Human Liver
MF-0127876-02 50 mg

Lactate Dehydrogenase 4, Human Liver

Sign In for Pricing
View Details
Indeglitazar 100mg
A21148-100 100 mg

Indeglitazar 100mg

Sign In for Pricing
View Details
OR51R1P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV739152 1.0 µg DNA

OR51R1P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details