Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free Neurturin, Mouse (His)

Neurturin, forming homodimers through disulfide links, promotes the survival of sympathetic neurons in culture.It potentially plays a role in regulating the development and maintenance of the central nervous system (CNS) and influencing the size of non-neuronal cell populations, such as haemopoietic cells.Animal-Free Neurturin Protein, Mouse (His) is the recombinant mouse-derived animal-FreeNeurturin protein, expressed by E.coli , with N-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free Neurturin Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-neurturin-protein-mouse-his.html

Purity

98.0

Smiles

PGARPCGLRELEVRVSELGLGYTSDETVLFRYCAGACEAAIRIYDLGLRRLRQRRRVRRERARAHPCCRPTAYEDEVSFLDVHSRYHTLQELSARECACV

Molecular Formula

18188 (Gene_ID) P97463.1 (P96-V195) (Accession)

Molecular Weight

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD32B (FCGR2B) (NM_001002274) Human Tagged ORF Clone Lentiviral Particle
RC212043L4V 200 µL

CD32B (FCGR2B) (NM_001002274) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
NFATC2 Antibody, Biotin conjugated
MBS7136252-01 0.05 mL

NFATC2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
NFATC2 Antibody, Biotin conjugated
MBS7136252-02 0.1 mL

NFATC2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
NFATC2 Antibody, Biotin conjugated
MBS7136252-03 5x 0.1 mL

NFATC2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Sox12 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
45135114 3x 1.0 µg

Sox12 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Reg3b Mouse qPCR Template Standard (NM_011036)
MK203924 1 Kit

Reg3b Mouse qPCR Template Standard (NM_011036)

Sign In for Pricing
View Details