Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free Neurturin, Mouse (His)

Neurturin, forming homodimers through disulfide links, promotes the survival of sympathetic neurons in culture.It potentially plays a role in regulating the development and maintenance of the central nervous system (CNS) and influencing the size of non-neuronal cell populations, such as haemopoietic cells.Animal-Free Neurturin Protein, Mouse (His) is the recombinant mouse-derived animal-FreeNeurturin protein, expressed by E.coli , with N-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free Neurturin Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-neurturin-protein-mouse-his.html

Purity

98.0

Smiles

PGARPCGLRELEVRVSELGLGYTSDETVLFRYCAGACEAAIRIYDLGLRRLRQRRRVRRERARAHPCCRPTAYEDEVSFLDVHSRYHTLQELSARECACV

Molecular Formula

18188 (Gene_ID) P97463.1 (P96-V195) (Accession)

Molecular Weight

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nkap (NM_001024872) Rat Tagged ORF Clone Lentiviral Particle
RR207954L4V 200 µL

Nkap (NM_001024872) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Analytical Grade Water - 10L
H2OB10AG 10 L

Analytical Grade Water - 10L

Sign In for Pricing
View Details
Tert-Butyl 3-[ (dimethylamino) methylene]-4-oxotetrahydro-1 (2H) -pyridinecarboxylate
sc-331796A 1 g

Tert-Butyl 3-[ (dimethylamino) methylene]-4-oxotetrahydro-1 (2H) -pyridinecarboxylate

Sign In for Pricing
View Details
Dscaml1 3'UTR Lenti-reporter-Luc Vector
18612084 1.0 µg

Dscaml1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
CPSF3L Protein Vector (Human) (pPM-C-HA)
PV010551 500 ng

CPSF3L Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS803012 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details