Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free Neurturin, Mouse (His)

Neurturin, forming homodimers through disulfide links, promotes the survival of sympathetic neurons in culture.It potentially plays a role in regulating the development and maintenance of the central nervous system (CNS) and influencing the size of non-neuronal cell populations, such as haemopoietic cells.Animal-Free Neurturin Protein, Mouse (His) is the recombinant mouse-derived animal-FreeNeurturin protein, expressed by E.coli , with N-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free Neurturin Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-neurturin-protein-mouse-his.html

Purity

98.0

Smiles

PGARPCGLRELEVRVSELGLGYTSDETVLFRYCAGACEAAIRIYDLGLRRLRQRRRVRRERARAHPCCRPTAYEDEVSFLDVHSRYHTLQELSARECACV

Molecular Formula

18188 (Gene_ID) P97463.1 (P96-V195) (Accession)

Molecular Weight

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pcdhb19 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
36149154 3x 1.0 µg DNA

Pcdhb19 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
LOC500413 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6596807 1.0 µg DNA

LOC500413 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Human ZNF20 activation kit by CRISPRa
GA105211 1 Kit

Human ZNF20 activation kit by CRISPRa

Sign In for Pricing
View Details
Vmn1r212 AAV siRNA Pooled Vector
49619164 1.0 µg

Vmn1r212 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
C5orf49 Protein Vector (Human) (pPM-N-D-C-His)
PV331321 500 ng

C5orf49 Protein Vector (Human) (pPM-N-D-C-His)

Sign In for Pricing
View Details
ANXA7 (Center) Rabbit pAb
MBS8555341-01 0.1 mL

ANXA7 (Center) Rabbit pAb

Sign In for Pricing
View Details