Animal-Free Neurturin, Mouse (His)
Neurturin, forming homodimers through disulfide links, promotes the survival of sympathetic neurons in culture.It potentially plays a role in regulating the development and maintenance of the central nervous system (CNS) and influencing the size of non-neuronal cell populations, such as haemopoietic cells.Animal-Free Neurturin Protein, Mouse (His) is the recombinant mouse-derived animal-FreeNeurturin protein, expressed by E.coli , with N-His labeled tag.This product is for cell culture use only.
Product Specifications
Product Name Alternative
Animal-Free Neurturin Protein, Mouse (His), Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/animal-free-neurturin-protein-mouse-his.html
Purity
98.0
Smiles
PGARPCGLRELEVRVSELGLGYTSDETVLFRYCAGACEAAIRIYDLGLRRLRQRRRVRRERARAHPCCRPTAYEDEVSFLDVHSRYHTLQELSARECACV
Molecular Formula
18188 (Gene_ID) P97463.1 (P96-V195) (Accession)
Molecular Weight
Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
RTBDN sgRNA CRISPR Lentivector (Human) (Target 2)
Stk39 Mouse shRNA Lentiviral Particle (Locus ID 53416)
CXorf26 (PBDC1) Human shRNA Plasmid Kit (Locus ID 51260)
Mouse Monoclonal 5'-Nucleotidase/CD73 Antibody (45M4F9) [Alexa Fluor 750]