Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free Neurturin, Mouse (His)

Neurturin, forming homodimers through disulfide links, promotes the survival of sympathetic neurons in culture.It potentially plays a role in regulating the development and maintenance of the central nervous system (CNS) and influencing the size of non-neuronal cell populations, such as haemopoietic cells.Animal-Free Neurturin Protein, Mouse (His) is the recombinant mouse-derived animal-FreeNeurturin protein, expressed by E.coli , with N-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free Neurturin Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-neurturin-protein-mouse-his.html

Purity

98.0

Smiles

PGARPCGLRELEVRVSELGLGYTSDETVLFRYCAGACEAAIRIYDLGLRRLRQRRRVRRERARAHPCCRPTAYEDEVSFLDVHSRYHTLQELSARECACV

Molecular Formula

18188 (Gene_ID) P97463.1 (P96-V195) (Accession)

Molecular Weight

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chk1 (phospho Ser317) Antibody
A7041-01 50 μL

Chk1 (phospho Ser317) Antibody

Sign In for Pricing
View Details
Chk1 (phospho Ser317) Antibody
A7041-02 100 µL

Chk1 (phospho Ser317) Antibody

Sign In for Pricing
View Details
Benzyl 2-Acetamido-2,6-dideoxy-3-O-β-D-galactopyranosyl α-D-Galactopyranoside
sc-503417 5 mg

Benzyl 2-Acetamido-2,6-dideoxy-3-O-β-D-galactopyranosyl α-D-Galactopyranoside

Sign In for Pricing
View Details
NARG1 (NMDA Receptor Regulated 1, Ga19, NATH, TBDN100) (MaxLight 550)
MBS6218189-01 0.1 mL

NARG1 (NMDA Receptor Regulated 1, Ga19, NATH, TBDN100) (MaxLight 550)

Sign In for Pricing
View Details
NARG1 (NMDA Receptor Regulated 1, Ga19, NATH, TBDN100) (MaxLight 550)
MBS6218189-02 5x 0.1 mL

NARG1 (NMDA Receptor Regulated 1, Ga19, NATH, TBDN100) (MaxLight 550)

Sign In for Pricing
View Details
Utp3 (NM_023054) Mouse Tagged Lenti ORF Clone
MR219458L4 10 µg

Utp3 (NM_023054) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details