Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free Neurturin, Mouse (His)

Neurturin, forming homodimers through disulfide links, promotes the survival of sympathetic neurons in culture.It potentially plays a role in regulating the development and maintenance of the central nervous system (CNS) and influencing the size of non-neuronal cell populations, such as haemopoietic cells.Animal-Free Neurturin Protein, Mouse (His) is the recombinant mouse-derived animal-FreeNeurturin protein, expressed by E.coli , with N-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free Neurturin Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-neurturin-protein-mouse-his.html

Purity

98.0

Smiles

PGARPCGLRELEVRVSELGLGYTSDETVLFRYCAGACEAAIRIYDLGLRRLRQRRRVRRERARAHPCCRPTAYEDEVSFLDVHSRYHTLQELSARECACV

Molecular Formula

18188 (Gene_ID) P97463.1 (P96-V195) (Accession)

Molecular Weight

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTCRA (NM_138296) Human Tagged ORF Clone Lentiviral Particle
RC215794L1V 200 µL

PTCRA (NM_138296) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
pBluescriptR-MINDY3 Plasmid
PVT22441 2 µg

pBluescriptR-MINDY3 Plasmid

Sign In for Pricing
View Details
Ptprs (NM_001252453) Mouse Untagged Clone
MC229607 10 µg

Ptprs (NM_001252453) Mouse Untagged Clone

Sign In for Pricing
View Details
mmu-miR-3547-5p miRNA Agomir
MBS8314681-01 5 nmol

mmu-miR-3547-5p miRNA Agomir

Sign In for Pricing
View Details
mmu-miR-3547-5p miRNA Agomir
MBS8314681-02 10 nmol

mmu-miR-3547-5p miRNA Agomir

Sign In for Pricing
View Details
mmu-miR-3547-5p miRNA Agomir
MBS8314681-03 20 nmol

mmu-miR-3547-5p miRNA Agomir

Sign In for Pricing
View Details