Animal-Free Neurturin, Mouse (His)
Neurturin, forming homodimers through disulfide links, promotes the survival of sympathetic neurons in culture.It potentially plays a role in regulating the development and maintenance of the central nervous system (CNS) and influencing the size of non-neuronal cell populations, such as haemopoietic cells.Animal-Free Neurturin Protein, Mouse (His) is the recombinant mouse-derived animal-FreeNeurturin protein, expressed by E.coli , with N-His labeled tag.This product is for cell culture use only.
Product Specifications
Product Name Alternative
Animal-Free Neurturin Protein, Mouse (His), Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/animal-free-neurturin-protein-mouse-his.html
Purity
98.0
Smiles
PGARPCGLRELEVRVSELGLGYTSDETVLFRYCAGACEAAIRIYDLGLRRLRQRRRVRRERARAHPCCRPTAYEDEVSFLDVHSRYHTLQELSARECACV
Molecular Formula
18188 (Gene_ID) P97463.1 (P96-V195) (Accession)
Molecular Weight
Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
Mouse IQ Motif Containing GTPase Activating Protein 2 (IQGAP2) CLIA Kit
Mouse IQ Motif Containing GTPase Activating Protein 2 (IQGAP2) CLIA Kit
Mouse IQ Motif Containing GTPase Activating Protein 2 (IQGAP2) CLIA Kit
Lentiviral human RASSF8 sgRNA gene knockout kit - Lentiviral human RASSF8 sgRNA gene knockout kit (100)