Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free Neurturin, Mouse (His)

Neurturin, forming homodimers through disulfide links, promotes the survival of sympathetic neurons in culture.It potentially plays a role in regulating the development and maintenance of the central nervous system (CNS) and influencing the size of non-neuronal cell populations, such as haemopoietic cells.Animal-Free Neurturin Protein, Mouse (His) is the recombinant mouse-derived animal-FreeNeurturin protein, expressed by E.coli , with N-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free Neurturin Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-neurturin-protein-mouse-his.html

Purity

98.0

Smiles

PGARPCGLRELEVRVSELGLGYTSDETVLFRYCAGACEAAIRIYDLGLRRLRQRRRVRRERARAHPCCRPTAYEDEVSFLDVHSRYHTLQELSARECACV

Molecular Formula

18188 (Gene_ID) P97463.1 (P96-V195) (Accession)

Molecular Weight

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RASL11B cDNA Clone
MBS1277499-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

RASL11B cDNA Clone

Sign In for Pricing
View Details
RASL11B cDNA Clone
MBS1277499-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

RASL11B cDNA Clone

Sign In for Pricing
View Details
L-772405
HY-120688 1 Each

L-772405

Sign In for Pricing
View Details
Lentiviral mouse Rnf122 shRNA (UAS) - Lentiviral mouse Rnf122 shRNA (UAS) (25)
GTR15108221 1 Vial

Lentiviral mouse Rnf122 shRNA (UAS) - Lentiviral mouse Rnf122 shRNA (UAS) (25)

Sign In for Pricing
View Details
MIR6339 Mouse qPCR Primer Pair (MI0021867)
MP300774 200 Reactions

MIR6339 Mouse qPCR Primer Pair (MI0021867)

Sign In for Pricing
View Details
RPS21P8 Adenovirus (Human)
42253051 1.0 mL

RPS21P8 Adenovirus (Human)

Sign In for Pricing
View Details