Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free Neurturin, Mouse (His)

Neurturin, forming homodimers through disulfide links, promotes the survival of sympathetic neurons in culture.It potentially plays a role in regulating the development and maintenance of the central nervous system (CNS) and influencing the size of non-neuronal cell populations, such as haemopoietic cells.Animal-Free Neurturin Protein, Mouse (His) is the recombinant mouse-derived animal-FreeNeurturin protein, expressed by E.coli , with N-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free Neurturin Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-neurturin-protein-mouse-his.html

Purity

98.0

Smiles

PGARPCGLRELEVRVSELGLGYTSDETVLFRYCAGACEAAIRIYDLGLRRLRQRRRVRRERARAHPCCRPTAYEDEVSFLDVHSRYHTLQELSARECACV

Molecular Formula

18188 (Gene_ID) P97463.1 (P96-V195) (Accession)

Molecular Weight

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti Human CXCL11 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(IHC)
MBS8421841-01 0.12 mL

Rabbit Anti Human CXCL11 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(IHC)

Sign In for Pricing
View Details
Rabbit Anti Human CXCL11 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(IHC)
MBS8421841-02 0.2 mL

Rabbit Anti Human CXCL11 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(IHC)

Sign In for Pricing
View Details
Rabbit Anti Human CXCL11 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(IHC)
MBS8421841-03 5x 0.2 mL

Rabbit Anti Human CXCL11 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(IHC)

Sign In for Pricing
View Details
Human ASPA/Aspartoacylase ELISA Kit
E0213Hu 96 Tests

Human ASPA/Aspartoacylase ELISA Kit

Sign In for Pricing
View Details
Rat Tspyl1 Pre-designed siRNA Set B
SI215318B 1 Each

Rat Tspyl1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
OR6B2 (NM_001005853) Human Tagged ORF Clone Lentiviral Particle
RC221562L3V 200 µL

OR6B2 (NM_001005853) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details