Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REG4, Rat (HEK293, His)

The REG4 protein is a calcium-dependent lectin that functions as a pattern recognition receptor (PRR) in the innate immune system. REG4 has specific affinity for α-mannan on Candida albicans hyphae and triggers phosphorylation of the FCER1G immunoreceptor tyrosine activation motif (ITAM), thereby activating SYK, CARD9 and NF-kappa-B. REG4 Protein, Rat (HEK293, His) is the recombinant rat-derived REG4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

REG4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/reg4-protein-rat-hek293-his.html

Purity

95.00

Smiles

DILRPSCASGWFNYRSHCYGYFRKLRNWSHAELECQSYGNGSHLASVLNPKEASVISKYITGYQRSLPVWIGLHDPQKNASWQWIDGSTNQYRPWSPRTKSEARHCTEMNPKDKFLTWNKNGCTKRQHFLCKYRP

Molecular Formula

445583 (Gene_ID) Q68AX7 (D23-P157) (Accession)

Molecular Weight

Approximately 20-31 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CRNN antibody
PAab01991 100 µg

Anti-CRNN antibody

Sign In for Pricing
View Details
5'-AMP-Activated Protein Kinase Subunit Gamma-1 (PRKAG1) Antibody
abx038328-01 100 µg

5'-AMP-Activated Protein Kinase Subunit Gamma-1 (PRKAG1) Antibody

Sign In for Pricing
View Details
5'-AMP-Activated Protein Kinase Subunit Gamma-1 (PRKAG1) Antibody
abx038328-02 1 mg

5'-AMP-Activated Protein Kinase Subunit Gamma-1 (PRKAG1) Antibody

Sign In for Pricing
View Details
Canine Interleukin 17 Receptor A (IL17RA) ELISA Kit-Sandwich
EK10F529-01 48 Test

Canine Interleukin 17 Receptor A (IL17RA) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Canine Interleukin 17 Receptor A (IL17RA) ELISA Kit-Sandwich
EK10F529-02 96 Tests

Canine Interleukin 17 Receptor A (IL17RA) ELISA Kit-Sandwich

Sign In for Pricing
View Details
RNF150 (NM_020724) Human Untagged Clone
SC304807 10 µg

RNF150 (NM_020724) Human Untagged Clone

Sign In for Pricing
View Details