Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REG4, Rat (HEK293, His)

The REG4 protein is a calcium-dependent lectin that functions as a pattern recognition receptor (PRR) in the innate immune system. REG4 has specific affinity for α-mannan on Candida albicans hyphae and triggers phosphorylation of the FCER1G immunoreceptor tyrosine activation motif (ITAM), thereby activating SYK, CARD9 and NF-kappa-B. REG4 Protein, Rat (HEK293, His) is the recombinant rat-derived REG4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

REG4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/reg4-protein-rat-hek293-his.html

Purity

95.00

Smiles

DILRPSCASGWFNYRSHCYGYFRKLRNWSHAELECQSYGNGSHLASVLNPKEASVISKYITGYQRSLPVWIGLHDPQKNASWQWIDGSTNQYRPWSPRTKSEARHCTEMNPKDKFLTWNKNGCTKRQHFLCKYRP

Molecular Formula

445583 (Gene_ID) Q68AX7 (D23-P157) (Accession)

Molecular Weight

Approximately 20-31 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

B16BL6 Luciferase Reporter Cell Line
ABC-RC030H 1 Vial

B16BL6 Luciferase Reporter Cell Line

Sign In for Pricing
View Details
Mouse Monoclonal Cadherin-17 Antibody (rCDH17/8514) [Alexa Fluor 647]
NBP3-20889AF647 0.1 mL

Mouse Monoclonal Cadherin-17 Antibody (rCDH17/8514) [Alexa Fluor 647]

Sign In for Pricing
View Details
Goat Lung resistance-related protein (LRP) ELISA Kit
EIA05983Go 1 Kit

Goat Lung resistance-related protein (LRP) ELISA Kit

Sign In for Pricing
View Details
MTG1 Protein Vector (Human) (pPB-C-His)
PV027041 500 ng

MTG1 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Rabbit Polyclonal CLPTM1 Antibody
NBP3-17231-100ul 100 µL

Rabbit Polyclonal CLPTM1 Antibody

Sign In for Pricing
View Details
Rabbit anti-Ashbya gossypii (strain 10895/CBS 109.51/FGSC 9923/NRRL Y-1056)(Yeast)(Eremothecium gossypii) SET1 Polyclonal Antibody
MBS7199428 Inquire

Rabbit anti-Ashbya gossypii (strain 10895/CBS 109.51/FGSC 9923/NRRL Y-1056)(Yeast)(Eremothecium gossypii) SET1 Polyclonal Antibody

Sign In for Pricing
View Details