Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REG4, Rat (HEK293, His)

The REG4 protein is a calcium-dependent lectin that functions as a pattern recognition receptor (PRR) in the innate immune system. REG4 has specific affinity for α-mannan on Candida albicans hyphae and triggers phosphorylation of the FCER1G immunoreceptor tyrosine activation motif (ITAM), thereby activating SYK, CARD9 and NF-kappa-B. REG4 Protein, Rat (HEK293, His) is the recombinant rat-derived REG4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

REG4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/reg4-protein-rat-hek293-his.html

Purity

95.00

Smiles

DILRPSCASGWFNYRSHCYGYFRKLRNWSHAELECQSYGNGSHLASVLNPKEASVISKYITGYQRSLPVWIGLHDPQKNASWQWIDGSTNQYRPWSPRTKSEARHCTEMNPKDKFLTWNKNGCTKRQHFLCKYRP

Molecular Formula

445583 (Gene_ID) Q68AX7 (D23-P157) (Accession)

Molecular Weight

Approximately 20-31 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRK4 Protein Vector (Rat) (pPM-C-HA)
PV271608 500 ng

GRK4 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Lentiviral mouse Phkb shRNA (UAS) - Lentiviral mouse Phkb shRNA (UAS) (25)
GTR15246281 1 Vial

Lentiviral mouse Phkb shRNA (UAS) - Lentiviral mouse Phkb shRNA (UAS) (25)

Sign In for Pricing
View Details
NEK10 Rabbit Polyclonal Antibody
TA350923 100 µL

NEK10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Habp2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K7322507 1.0 µg DNA

Habp2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Recombinant Mouse Neuferricin (Cyb5d2)
MBS1482983-01 0.02 mg (E-Coli)

Recombinant Mouse Neuferricin (Cyb5d2)

Sign In for Pricing
View Details
Recombinant Mouse Neuferricin (Cyb5d2)
MBS1482983-02 0.1 mg (E-Coli)

Recombinant Mouse Neuferricin (Cyb5d2)

Sign In for Pricing
View Details