Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REG4, Rat (HEK293, His)

The REG4 protein is a calcium-dependent lectin that functions as a pattern recognition receptor (PRR) in the innate immune system. REG4 has specific affinity for α-mannan on Candida albicans hyphae and triggers phosphorylation of the FCER1G immunoreceptor tyrosine activation motif (ITAM), thereby activating SYK, CARD9 and NF-kappa-B. REG4 Protein, Rat (HEK293, His) is the recombinant rat-derived REG4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

REG4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/reg4-protein-rat-hek293-his.html

Purity

95.00

Smiles

DILRPSCASGWFNYRSHCYGYFRKLRNWSHAELECQSYGNGSHLASVLNPKEASVISKYITGYQRSLPVWIGLHDPQKNASWQWIDGSTNQYRPWSPRTKSEARHCTEMNPKDKFLTWNKNGCTKRQHFLCKYRP

Molecular Formula

445583 (Gene_ID) Q68AX7 (D23-P157) (Accession)

Molecular Weight

Approximately 20-31 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Feline IFN-gamma Recombinant Protein
PROTP46402-250ug 250 µg

Feline IFN-gamma Recombinant Protein

Sign In for Pricing
View Details
2700059D21Rik (BC082305) Mouse Tagged Lenti ORF Clone
MR200699L4 10 µg

2700059D21Rik (BC082305) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mcm5 (NM_001106170) Rat Tagged ORF Clone Lentiviral Particle
RR209849L3V 200 µL

Mcm5 (NM_001106170) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
GPR73B (PROKR2) Rabbit Polyclonal Antibody
TA372681 100 µL

GPR73B (PROKR2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Symetine 50mg
A19232-50 50 mg

Symetine 50mg

Sign In for Pricing
View Details
C5ORF44 (TRAPPC13) (NM_001093755) Human Recombinant Protein
TP761014 50 µg

C5ORF44 (TRAPPC13) (NM_001093755) Human Recombinant Protein

Sign In for Pricing
View Details