REG4, Rat (HEK293, His)
The REG4 protein is a calcium-dependent lectin that functions as a pattern recognition receptor (PRR) in the innate immune system. REG4 has specific affinity for α-mannan on Candida albicans hyphae and triggers phosphorylation of the FCER1G immunoreceptor tyrosine activation motif (ITAM), thereby activating SYK, CARD9 and NF-kappa-B. REG4 Protein, Rat (HEK293, His) is the recombinant rat-derived REG4 protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
REG4 Protein, Rat (HEK293, His), Rat, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/reg4-protein-rat-hek293-his.html
Purity
95.00
Smiles
DILRPSCASGWFNYRSHCYGYFRKLRNWSHAELECQSYGNGSHLASVLNPKEASVISKYITGYQRSLPVWIGLHDPQKNASWQWIDGSTNQYRPWSPRTKSEARHCTEMNPKDKFLTWNKNGCTKRQHFLCKYRP
Molecular Formula
445583 (Gene_ID) Q68AX7 (D23-P157) (Accession)
Molecular Weight
Approximately 20-31 kDa due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
C17orf76 (LRRC75A) (NM_207387) Human Tagged Lenti ORF Clone
Lentiviral human LRRC8C shRNA (UAS) - Lentiviral human LRRC8C shRNA (UAS, iRFP) (100)
PTBP2 (Polypyrimidine Tract-binding Protein 2, PTB, nPTB, PTBLP, brPTB, nPTB5, nPTB6, nPTB7, nPTB8) (MaxLight 405)