Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REG4, Rat (HEK293, His)

The REG4 protein is a calcium-dependent lectin that functions as a pattern recognition receptor (PRR) in the innate immune system. REG4 has specific affinity for α-mannan on Candida albicans hyphae and triggers phosphorylation of the FCER1G immunoreceptor tyrosine activation motif (ITAM), thereby activating SYK, CARD9 and NF-kappa-B. REG4 Protein, Rat (HEK293, His) is the recombinant rat-derived REG4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

REG4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/reg4-protein-rat-hek293-his.html

Purity

95.00

Smiles

DILRPSCASGWFNYRSHCYGYFRKLRNWSHAELECQSYGNGSHLASVLNPKEASVISKYITGYQRSLPVWIGLHDPQKNASWQWIDGSTNQYRPWSPRTKSEARHCTEMNPKDKFLTWNKNGCTKRQHFLCKYRP

Molecular Formula

445583 (Gene_ID) Q68AX7 (D23-P157) (Accession)

Molecular Weight

Approximately 20-31 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CREBBP protein, N-His Tag
IMP-3704 10 µg

Recombinant Human CREBBP protein, N-His Tag

Sign In for Pricing
View Details
JPT1 (NM_001002033) Human Recombinant Protein
TP307344L 1 mg

JPT1 (NM_001002033) Human Recombinant Protein

Sign In for Pricing
View Details
Rabbit Polyclonal DCP2 Antibody
NBP2-56996 100 µL

Rabbit Polyclonal DCP2 Antibody

Sign In for Pricing
View Details
Dog IL1b Matched Antibody Pair Set [ABP-S-051964]
ABP-S-051964 5 Plates

Dog IL1b Matched Antibody Pair Set [ABP-S-051964]

Sign In for Pricing
View Details
Rat Prostaglandin E synthase 3 ELISA Kit
MBS2882992-01 48 Well

Rat Prostaglandin E synthase 3 ELISA Kit

Sign In for Pricing
View Details
Rat Prostaglandin E synthase 3 ELISA Kit
MBS2882992-02 96 Well

Rat Prostaglandin E synthase 3 ELISA Kit

Sign In for Pricing
View Details