Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REG4, Rat (HEK293, His)

The REG4 protein is a calcium-dependent lectin that functions as a pattern recognition receptor (PRR) in the innate immune system. REG4 has specific affinity for α-mannan on Candida albicans hyphae and triggers phosphorylation of the FCER1G immunoreceptor tyrosine activation motif (ITAM), thereby activating SYK, CARD9 and NF-kappa-B. REG4 Protein, Rat (HEK293, His) is the recombinant rat-derived REG4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

REG4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/reg4-protein-rat-hek293-his.html

Purity

95.00

Smiles

DILRPSCASGWFNYRSHCYGYFRKLRNWSHAELECQSYGNGSHLASVLNPKEASVISKYITGYQRSLPVWIGLHDPQKNASWQWIDGSTNQYRPWSPRTKSEARHCTEMNPKDKFLTWNKNGCTKRQHFLCKYRP

Molecular Formula

445583 (Gene_ID) Q68AX7 (D23-P157) (Accession)

Molecular Weight

Approximately 20-31 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS18P10 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV783736 1.0 µg DNA

RPS18P10 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Mouse CADM4 HEK293 Overexpression Lysate
MBS8116656-01 0.3 mg

Mouse CADM4 HEK293 Overexpression Lysate

Sign In for Pricing
View Details
Mouse CADM4 HEK293 Overexpression Lysate
MBS8116656-02 5x 0.3 mg

Mouse CADM4 HEK293 Overexpression Lysate

Sign In for Pricing
View Details
Heat Shock Factor 1 (HSF1) Human ELISA Kit
D9521 96 Tests

Heat Shock Factor 1 (HSF1) Human ELISA Kit

Sign In for Pricing
View Details
Recombinant Hepatitis C Virus NS5, Horseradish Peroxidase Labled
7-07381 100 µg

Recombinant Hepatitis C Virus NS5, Horseradish Peroxidase Labled

Sign In for Pricing
View Details
Recombinant Oenothera argillicola ATP synthase subunit c, chloroplastic (atpH)
MBS7010070-01 0.02 mg

Recombinant Oenothera argillicola ATP synthase subunit c, chloroplastic (atpH)

Sign In for Pricing
View Details