Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REG4, Rat (HEK293, His)

The REG4 protein is a calcium-dependent lectin that functions as a pattern recognition receptor (PRR) in the innate immune system. REG4 has specific affinity for α-mannan on Candida albicans hyphae and triggers phosphorylation of the FCER1G immunoreceptor tyrosine activation motif (ITAM), thereby activating SYK, CARD9 and NF-kappa-B. REG4 Protein, Rat (HEK293, His) is the recombinant rat-derived REG4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

REG4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/reg4-protein-rat-hek293-his.html

Purity

95.00

Smiles

DILRPSCASGWFNYRSHCYGYFRKLRNWSHAELECQSYGNGSHLASVLNPKEASVISKYITGYQRSLPVWIGLHDPQKNASWQWIDGSTNQYRPWSPRTKSEARHCTEMNPKDKFLTWNKNGCTKRQHFLCKYRP

Molecular Formula

445583 (Gene_ID) Q68AX7 (D23-P157) (Accession)

Molecular Weight

Approximately 20-31 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LY2452473 10mg
A16873-10 10 mg

LY2452473 10mg

Sign In for Pricing
View Details
Rabbit Anti-Human CCKBR pAb
PA13217-01 50 μL

Rabbit Anti-Human CCKBR pAb

Sign In for Pricing
View Details
Rabbit Anti-Human CCKBR pAb
PA13217-02 100 μL

Rabbit Anti-Human CCKBR pAb

Sign In for Pricing
View Details
CASP10 (Caspase 10, Apoptosis-Related Cysteine Peptidase, ALPS2, FLICE2, MCH4)
244238 100 µg

CASP10 (Caspase 10, Apoptosis-Related Cysteine Peptidase, ALPS2, FLICE2, MCH4)

Sign In for Pricing
View Details
PIRC110 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV740988 1.0 µg DNA

PIRC110 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Human Cytochrome P450 2D6 (CYP2D6) ELISA Kit
MBS2705032-01 24 Strip Well

Human Cytochrome P450 2D6 (CYP2D6) ELISA Kit

Sign In for Pricing
View Details