REG4, Rat (HEK293, His)
The REG4 protein is a calcium-dependent lectin that functions as a pattern recognition receptor (PRR) in the innate immune system. REG4 has specific affinity for α-mannan on Candida albicans hyphae and triggers phosphorylation of the FCER1G immunoreceptor tyrosine activation motif (ITAM), thereby activating SYK, CARD9 and NF-kappa-B. REG4 Protein, Rat (HEK293, His) is the recombinant rat-derived REG4 protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
REG4 Protein, Rat (HEK293, His), Rat, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/reg4-protein-rat-hek293-his.html
Purity
95.00
Smiles
DILRPSCASGWFNYRSHCYGYFRKLRNWSHAELECQSYGNGSHLASVLNPKEASVISKYITGYQRSLPVWIGLHDPQKNASWQWIDGSTNQYRPWSPRTKSEARHCTEMNPKDKFLTWNKNGCTKRQHFLCKYRP
Molecular Formula
445583 (Gene_ID) Q68AX7 (D23-P157) (Accession)
Molecular Weight
Approximately 20-31 kDa due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
YY1, ID (YY1, INO80S, Transcriptional repressor protein YY1, Delta transcription factor, INO80 complex subunit S, NF-E1, Yin and yang 1) (FITC)
YY1, ID (YY1, INO80S, Transcriptional repressor protein YY1, Delta transcription factor, INO80 complex subunit S, NF-E1, Yin and yang 1) (FITC)
Recombinant Salmonella agona Spermidine export protein MdtJ (mdtJ)
Recombinant Salmonella agona Spermidine export protein MdtJ (mdtJ)
Recombinant Salmonella agona Spermidine export protein MdtJ (mdtJ)
