Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REG4, Rat (HEK293, His)

The REG4 protein is a calcium-dependent lectin that functions as a pattern recognition receptor (PRR) in the innate immune system. REG4 has specific affinity for α-mannan on Candida albicans hyphae and triggers phosphorylation of the FCER1G immunoreceptor tyrosine activation motif (ITAM), thereby activating SYK, CARD9 and NF-kappa-B. REG4 Protein, Rat (HEK293, His) is the recombinant rat-derived REG4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

REG4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/reg4-protein-rat-hek293-his.html

Purity

95.00

Smiles

DILRPSCASGWFNYRSHCYGYFRKLRNWSHAELECQSYGNGSHLASVLNPKEASVISKYITGYQRSLPVWIGLHDPQKNASWQWIDGSTNQYRPWSPRTKSEARHCTEMNPKDKFLTWNKNGCTKRQHFLCKYRP

Molecular Formula

445583 (Gene_ID) Q68AX7 (D23-P157) (Accession)

Molecular Weight

Approximately 20-31 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal MOBKL2B Antibody (OTI6C6) [CoraFluor 1]
NBP2-72748CL1 0.1 mL

Mouse Monoclonal MOBKL2B Antibody (OTI6C6) [CoraFluor 1]

Sign In for Pricing
View Details
Recombinant Human MPHOSPH10 Protein, N-His
YHA15801 100 μg

Recombinant Human MPHOSPH10 Protein, N-His

Sign In for Pricing
View Details
Recombinant Staphylococcus Aureus rplS Protein (aa 1-116)
VAng-Cr6159-500gEcoli 500 µg (E. coli)

Recombinant Staphylococcus Aureus rplS Protein (aa 1-116)

Sign In for Pricing
View Details
Human CD80
117165 100 µg

Human CD80

Sign In for Pricing
View Details
Lmo7 3'UTR Luciferase Stable Cell Line
TU207140 1.0 mL

Lmo7 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
FGFR1OP2 antibody
70R-17294 50 ul

FGFR1OP2 antibody

Sign In for Pricing
View Details