Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REG4, Rat (HEK293, His)

The REG4 protein is a calcium-dependent lectin that functions as a pattern recognition receptor (PRR) in the innate immune system. REG4 has specific affinity for α-mannan on Candida albicans hyphae and triggers phosphorylation of the FCER1G immunoreceptor tyrosine activation motif (ITAM), thereby activating SYK, CARD9 and NF-kappa-B. REG4 Protein, Rat (HEK293, His) is the recombinant rat-derived REG4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

REG4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/reg4-protein-rat-hek293-his.html

Purity

95.00

Smiles

DILRPSCASGWFNYRSHCYGYFRKLRNWSHAELECQSYGNGSHLASVLNPKEASVISKYITGYQRSLPVWIGLHDPQKNASWQWIDGSTNQYRPWSPRTKSEARHCTEMNPKDKFLTWNKNGCTKRQHFLCKYRP

Molecular Formula

445583 (Gene_ID) Q68AX7 (D23-P157) (Accession)

Molecular Weight

Approximately 20-31 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Slc34a2 activation kit by CRISPRa
GA203957 1 Kit

Mouse Slc34a2 activation kit by CRISPRa

Sign In for Pricing
View Details
Human TSSK6 knockdown cell line
ABC-KD16256 1 Vial

Human TSSK6 knockdown cell line

Sign In for Pricing
View Details
LAMP1-mGFP Plasmid
PVT74970 2 µg

LAMP1-mGFP Plasmid

Sign In for Pricing
View Details
Anti-Phospho-Ets-1 (S251) antibody
STJ91277 200 µl

Anti-Phospho-Ets-1 (S251) antibody

Sign In for Pricing
View Details
[KO Validated] PD-L1/CD274 Rabbit mAb
E45R12668N-50 50 µL

[KO Validated] PD-L1/CD274 Rabbit mAb

Sign In for Pricing
View Details
MGC10701 Human shRNA Lentiviral Particle (Locus ID 84744)
TL319177V 500 µL Each

MGC10701 Human shRNA Lentiviral Particle (Locus ID 84744)

Sign In for Pricing
View Details