Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REG4, Rat (HEK293, His)

The REG4 protein is a calcium-dependent lectin that functions as a pattern recognition receptor (PRR) in the innate immune system. REG4 has specific affinity for α-mannan on Candida albicans hyphae and triggers phosphorylation of the FCER1G immunoreceptor tyrosine activation motif (ITAM), thereby activating SYK, CARD9 and NF-kappa-B. REG4 Protein, Rat (HEK293, His) is the recombinant rat-derived REG4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

REG4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/reg4-protein-rat-hek293-his.html

Purity

95.00

Smiles

DILRPSCASGWFNYRSHCYGYFRKLRNWSHAELECQSYGNGSHLASVLNPKEASVISKYITGYQRSLPVWIGLHDPQKNASWQWIDGSTNQYRPWSPRTKSEARHCTEMNPKDKFLTWNKNGCTKRQHFLCKYRP

Molecular Formula

445583 (Gene_ID) Q68AX7 (D23-P157) (Accession)

Molecular Weight

Approximately 20-31 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Proton-coupled amino Acid Transporter 3 (SLC36A3) Mouse ELISA Kit
G4828 96 Tests

Proton-coupled amino Acid Transporter 3 (SLC36A3) Mouse ELISA Kit

Sign In for Pricing
View Details
Formyl Peptide Receptor 1 (FPR1) Antibody
abx009251-01 30 µL

Formyl Peptide Receptor 1 (FPR1) Antibody

Sign In for Pricing
View Details
Formyl Peptide Receptor 1 (FPR1) Antibody
abx009251-02 100 µL

Formyl Peptide Receptor 1 (FPR1) Antibody

Sign In for Pricing
View Details
Formyl Peptide Receptor 1 (FPR1) Antibody
abx009251-03 200 µL

Formyl Peptide Receptor 1 (FPR1) Antibody

Sign In for Pricing
View Details
Rat Calprotectin (CALP) ELISA Kit
MBS1600210-01 48 Well

Rat Calprotectin (CALP) ELISA Kit

Sign In for Pricing
View Details
Rat Calprotectin (CALP) ELISA Kit
MBS1600210-02 96 Well

Rat Calprotectin (CALP) ELISA Kit

Sign In for Pricing
View Details