Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REG4, Rat (HEK293, His)

The REG4 protein is a calcium-dependent lectin that functions as a pattern recognition receptor (PRR) in the innate immune system. REG4 has specific affinity for α-mannan on Candida albicans hyphae and triggers phosphorylation of the FCER1G immunoreceptor tyrosine activation motif (ITAM), thereby activating SYK, CARD9 and NF-kappa-B. REG4 Protein, Rat (HEK293, His) is the recombinant rat-derived REG4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

REG4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/reg4-protein-rat-hek293-his.html

Purity

95.00

Smiles

DILRPSCASGWFNYRSHCYGYFRKLRNWSHAELECQSYGNGSHLASVLNPKEASVISKYITGYQRSLPVWIGLHDPQKNASWQWIDGSTNQYRPWSPRTKSEARHCTEMNPKDKFLTWNKNGCTKRQHFLCKYRP

Molecular Formula

445583 (Gene_ID) Q68AX7 (D23-P157) (Accession)

Molecular Weight

Approximately 20-31 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Caspase-14 Antibody (101) [mFluor Violet 610 SE]
NBP2-90006MFV610 0.1 mL

Rabbit Monoclonal Caspase-14 Antibody (101) [mFluor Violet 610 SE]

Sign In for Pricing
View Details
FGF1 (Fibroblast Growth Factor 1 (Acidic), AFGF, ECGF, ECGF-beta, ECGFA, ECGFB, FGF-alpha, FGFA, GLIO703, HBGF1) (MaxLight 650)
MBS6227509-01 0.1 mL

FGF1 (Fibroblast Growth Factor 1 (Acidic), AFGF, ECGF, ECGF-beta, ECGFA, ECGFB, FGF-alpha, FGFA, GLIO703, HBGF1) (MaxLight 650)

Sign In for Pricing
View Details
FGF1 (Fibroblast Growth Factor 1 (Acidic), AFGF, ECGF, ECGF-beta, ECGFA, ECGFB, FGF-alpha, FGFA, GLIO703, HBGF1) (MaxLight 650)
MBS6227509-02 5x 0.1 mL

FGF1 (Fibroblast Growth Factor 1 (Acidic), AFGF, ECGF, ECGF-beta, ECGFA, ECGFB, FGF-alpha, FGFA, GLIO703, HBGF1) (MaxLight 650)

Sign In for Pricing
View Details
DGKG (Diacylglycerol Kinase gamma, DAG Kinase gamma, Diglyceride Kinase gamma, DGK-gamma, DAGK3) (MaxLight 550)
125800-ML550 100 µL

DGKG (Diacylglycerol Kinase gamma, DAG Kinase gamma, Diglyceride Kinase gamma, DGK-gamma, DAGK3) (MaxLight 550)

Sign In for Pricing
View Details
LOX1 (LOX-1, hLOX-1, C-type Lectin Domain Family 8 Member A, CLEC8A, Lectin-like Oxidized LDL Receptor 1, Lectin-like oxLDL Receptor 1, Lectin-type Oxidized LDL Receptor 1, LOXIN, Oxidized Low-density Lipoprotein Receptor 1, Ox-LDL Receptor 1, OLR1, SCARE1, SLOX1) (APC) discontinued
L3514-54C-APC 100 µL

LOX1 (LOX-1, hLOX-1, C-type Lectin Domain Family 8 Member A, CLEC8A, Lectin-like Oxidized LDL Receptor 1, Lectin-like oxLDL Receptor 1, Lectin-type Oxidized LDL Receptor 1, LOXIN, Oxidized Low-density Lipoprotein Receptor 1, Ox-LDL Receptor 1, OLR1, SCARE1, SLOX1) (APC) discontinued

Sign In for Pricing
View Details
Mouse Monoclonal Renalase Antibody (RNLS/1940)
NBP3-07666-20ug 20 µg

Mouse Monoclonal Renalase Antibody (RNLS/1940)

Sign In for Pricing
View Details