Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REG4, Rat (HEK293, His)

The REG4 protein is a calcium-dependent lectin that functions as a pattern recognition receptor (PRR) in the innate immune system. REG4 has specific affinity for α-mannan on Candida albicans hyphae and triggers phosphorylation of the FCER1G immunoreceptor tyrosine activation motif (ITAM), thereby activating SYK, CARD9 and NF-kappa-B. REG4 Protein, Rat (HEK293, His) is the recombinant rat-derived REG4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

REG4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/reg4-protein-rat-hek293-his.html

Purity

95.00

Smiles

DILRPSCASGWFNYRSHCYGYFRKLRNWSHAELECQSYGNGSHLASVLNPKEASVISKYITGYQRSLPVWIGLHDPQKNASWQWIDGSTNQYRPWSPRTKSEARHCTEMNPKDKFLTWNKNGCTKRQHFLCKYRP

Molecular Formula

445583 (Gene_ID) Q68AX7 (D23-P157) (Accession)

Molecular Weight

Approximately 20-31 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GLI4 Rabbit pAb
E47R13373 100 µL

GLI4 Rabbit pAb

Sign In for Pricing
View Details
Anti-Myosin 1C Antibody
STJ501852 100 µg

Anti-Myosin 1C Antibody

Sign In for Pricing
View Details
TNNI2 (Troponin I Type 2, Fast Skeletal, DA2B, FSSV, fsTnI, AMCD2B) (MaxLight 405)
MBS6441142-01 0.1 mL

TNNI2 (Troponin I Type 2, Fast Skeletal, DA2B, FSSV, fsTnI, AMCD2B) (MaxLight 405)

Sign In for Pricing
View Details
TNNI2 (Troponin I Type 2, Fast Skeletal, DA2B, FSSV, fsTnI, AMCD2B) (MaxLight 405)
MBS6441142-02 5x 0.1 mL

TNNI2 (Troponin I Type 2, Fast Skeletal, DA2B, FSSV, fsTnI, AMCD2B) (MaxLight 405)

Sign In for Pricing
View Details
eEF1 alpha antibody
70R-34919 100 ug

eEF1 alpha antibody

Sign In for Pricing
View Details
STK11IP Protein Lysate
OCOA02965-20UG 20 µg

STK11IP Protein Lysate

Sign In for Pricing
View Details